|
|
|
|
|
|
|
|
-
LOCUS Dscam 7699 bp mRNA linear INV 31-JUL-2002
DEFINITION Drosophila melanogaster Down syndrome cell adhesion molecule
(Dscam), mRNA.
ACCESSION NM_078925
VERSION NM_078925.2 GI:22023980
KEYWORDS .
SOURCE fruit fly.
ORGANISM Drosophila melanogaster
Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;
Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha;
Ephydroidea; Drosophilidae; Drosophila.
REFERENCE 1 (bases 1 to 7699)
AUTHORS Adams,M.D., Celniker,S.E., Holt,R.A., Evans,C.A., Gocayne,J.D.,
Amanatides,P.G., Scherer,S.E., Li,P.W., Hoskins,R.A., Galle,R.F.,
George,R.A., Lewis,S.E., Richards,S., Ashburner,M., Henderson,S.N.,
Sutton,G.G., Wortman,J.R., Yandell,M.D., Zhang,Q., Chen,L.X.,
Brandon,R.C., Rogers,Y.H., Blazej,R.G., Champe,M., Pfeiffer,B.D.,
Wan,K.H., Doyle,C., Baxter,E.G., Helt,G., Nelson,C.R., Gabor
Miklos,G.L., Abril,J.F., Agbayani,A., An,H.J.,
Andrews-Pfannkoch,C., Baldwin,D., Ballew,R.M., Basu,A.,
Baxendale,J., Bayraktaroglu,L., Beasley,E.M., Beeson,K.Y.,
Benos,P.V., Berman,B.P., Bhandari,D., Bolshakov,S., Borkova,D.,
Botchan,M.R., Bouck,J., Brokstein,P., Brottier,P., Burtis,K.C.,
Busam,D.A., Butler,H., Cadieu,E., Center,A., Chandra,I.,
Cherry,J.M., Cawley,S., Dahlke,C., Davenport,L.B., Davies,P., de
Pablos,B., Delcher,A., Deng,Z., Mays,A.D., Dew,I., Dietz,S.M.,
Dodson,K., Doup,L.E., Downes,M., Dugan-Rocha,S., Dunkov,B.C.,
Dunn,P., Durbin,K.J., Evangelista,C.C., Ferraz,C., Ferriera,S.,
Fleischmann,W., Fosler,C., Gabrielian,A.E., Garg,N.S.,
Gelbart,W.M., Glasser,K., Glodek,A., Gong,F., Gorrell,J.H., Gu,Z.,
Guan,P., Harris,M., Harris,N.L., Harvey,D., Heiman,T.J.,
Hernandez,J.R., Houck,J., Hostin,D., Houston,K.A., Howland,T.J.,
Wei,M.H., Ibegwam,C., Jalali,M., Kalush,F., Karpen,G.H., Ke,Z.,
Kennison,J.A., Ketchum,K.A., Kimmel,B.E., Kodira,C.D., Kraft,C.,
Kravitz,S., Kulp,D., Lai,Z., Lasko,P., Lei,Y., Levitsky,A.A.,
Li,J., Li,Z., Liang,Y., Lin,X., Liu,X., Mattei,B., McIntosh,T.C.,
McLeod,M.P., McPherson,D., Merkulov,G., Milshina,N.V., Mobarry,C.,
Morris,J., Moshrefi,A., Mount,S.M., Moy,M., Murphy,B., Murphy,L.,
Muzny,D.M., Nelson,D.L., Nelson,D.R., Nelson,K.A., Nixon,K.,
Nusskern,D.R., Pacleb,J.M., Palazzolo,M., Pittman,G.S., Pan,S.,
Pollard,J., Puri,V., Reese,M.G., Reinert,K., Remington,K.,
Saunders,R.D., Scheeler,F., Shen,H., Shue,B.C., Siden-Kiamos,I.,
Simpson,M., Skupski,M.P., Smith,T., Spier,E., Spradling,A.C.,
Stapleton,M., Strong,R., Sun,E., Svirskas,R., Tector,C., Turner,R.,
Venter,E., Wang,A.H., Wang,X., Wang,Z.Y., Wassarman,D.A.,
Weinstock,G.M., Weissenbach,J., Williams,S.M., Woodage,T.,
Worley,K.C., Wu,D., Yang,S., Yao,Q.A., Ye,J., Yeh,R.F.,
Zaveri,J.S., Zhan,M., Zhang,G., Zhao,Q., Zheng,L., Zheng,X.H.,
Zhong,F.N., Zhong,W., Zhou,X., Zhu,S., Zhu,X., Smith,H.O.,
Gibbs,R.A., Myers,E.W., Rubin,G.M. and Venter,J.C.
TITLE The genome sequence of Drosophila melanogaster
JOURNAL Science 287 (5461), 2185-2195 (2000)
MEDLINE 20196006
PUBMED 10731132
REFERENCE 2 (bases 1 to 7699)
AUTHORS Schmucker,D., Clemens,J.C., Shu,H., Worby,C.A., Xiao,J., Muda,M.,
Dixon,J.E. and Zipursky,S.L.
TITLE Drosophila Dscam is an axon guidance receptor exhibiting
extraordinary molecular diversity
JOURNAL Cell 101 (6), 671-684 (2000)
MEDLINE 20348742
PUBMED 10892653
REFERENCE 3 (bases 1 to 7699)
AUTHORS Amanatides,P.G., Brandon,R.C., Rogers,Y., An,H., Baldwin,D.,
Banzon,J., Beeson,K.Y., Busam,D.A., Carlson,J.W., Center,A.,
Champe,M., Davenport,L.B., Dietz,S.M., Dodson,K., Dorsett,V.,
Doup,L.E., Doyle,C., Dresnek,D., Farfan,D., Ferriera,S., Frise,E.,
Galle,R.F., Garg,N.S., George,R.A., Gonzalez,M., Houck,J.,
Hoskins,R.A., Hostin,D., Howland,T.J., Ibegwam,C., Jalali,M.,
Kruse,D., Li,P., Mattei,B., Moshrefi,A., McIntosh,T.C., Moy,M.,
Murphy,B., Nelson,C., Nelson,K.A., Nunoo,J., Pacleb,J., Paragas,V.,
Park,S., Patel,S., Pfeiffer,B., Phouanenavong,S., Pittman,G.S.,
Puri,V., Richards,S., Scheeler,F., Stapleton,M., Strong,R.,
Svirskas,R., Tector,C., Tyler,D., Williams,S.M., Zaveri,J.S.,
Smith,H.O., Venter,J.C. and Rubin,G.M.
TITLE Sequencing of Drosophila melanogaster genome
JOURNAL Unpublished
REFERENCE 4 (bases 1 to 7699)
AUTHORS Misra,S., Crosby,M.A., Matthews,B.B., Bayraktaroglu,L.,
Campbell,K., Hradecky,P., Huang,Y., Kaminker,J.S., Prochnik,S.E.,
Smith,C.D., Tupy,J.L., Bergman,C.M., Berman,B.P., Carlson,J.W.,
Celniker,S.E., Clamp,M.E., Drysdale,R.A., Emmert,D., Frise,E., de
Grey,A.D.N.J., Harris,N.L., Kronmiller,B., Marshall,B.,
Millburn,G.H., Richter,J., Russo,S., Searle,S.M.J., Smith,E.,
Shu,S., Smutniak,F., Whitfield,E.J., Yamada,C., Ashburner,M.,
Gelbart,W.M., Rubin,G.M., Mungall,C.J. and Lewis,S.E.
TITLE Annotation of Drosophila melanogaster genome
JOURNAL Unpublished
COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final
NCBI review. The reference sequence was derived from AE003841.3.
On Jul 31, 2002 this sequence version replaced gi:17647366.
FEATURES Location/Qualifiers
source 1..7699
/organism="Drosophila melanogaster"
/db_xref="taxon:7227"
/chromosome="2"
/map="43B1-43B3"
gene 1..7699
/gene="Dscam"
/note="43Bc; p270; Dscam1; CG17800; CT39257; l(2)43Bc;
l(2)05518"
/db_xref="FLYBASE:FBgn0033159;"
/db_xref="LocusID:35652"
CDS 520..6570
/gene="Dscam"
/note="lethal(2)43Bc"
/codon_start=1
/product="Down syndrome cell adhesion molecule"
/protein_id="NP_523649.2"
/db_xref="GI:22023981"
/db_xref="FLYBASE:FBgn0033159;"
/db_xref="LocusID:35652"
/translation="MNMPNERLKWLMLFAAVALIACGSQTLAANPPDADQKGPVFLKE
PTNRIDFSNSTGAEIECKASGNPMPEIIWIRSDGTAVGDVPGLRQISSDGKLVFPPFR
AEDYRQEVHAQVYACLARNQFGSIISRDVHVRAVVAQYYEADVNKEHVIRGNSAVIKC
LIPSFVADFVEVVSWHTDEEENYFPGAEYDGKYLVLPSGELHIREVGPEDGYKSYQCR
TKHRLTGETRLSATKGRLVITEPVSSSPPKINALTYKPNIVESMASTAILCPAQGYPA
PSFRWYKFIEGTTRKQAVVLNDRVKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVE
TVLTVTAPLSAKIDPPTQTVDFGRPAVFTCQYTGNPIKTVSWMKDGKAIGHSEPVLRI
ESVKKEDKGMYQCFVRNDQESAEASAELKLGGRFDPPVIRQAFQEETMEPGPSVFLKC
VAGGNPTPEISWELDGKKIANNDRYQVGQYVTVNGDVVSYLNITSVHANDGGLYKCIA
KSKVGVAEHSAKLNVYGLPYIRQMEKKAIVAGETLIVTCPVAGYPIDSIVWERDNRAL
PINRKQKVFPNGTLIIENVERNSDQATYTCVAKNQEGYSARGSLEVQVMVPPQVLPFS
FGESAADVGDIASANCVVPKGDLPLEIRWSLNSAPIVNGENGFTLVRLNKRTSLLNID
SLNAFHRGVYKCIATNPAGTSEYVAELQVNVPPRWILEPTDKAFAQGSDAKVECKADG
FPKPQVTWKKAVGDTPGEYKDLKKSDNIRVEEGTLHVDNIQKTNEGYYLCEAINGIGS
GLSAVIMISVQAPPEFTEKLRNQTARRGEPAVLQCEAKGEKPIGILWNMNNMRLDPKN
DNRYTIREEILSTGVMSSLSIKRTERSDSALFTCVATNAFGSDDASINMIVQEVPEMP
YALKVLDKSGRSVQLSWAQPYDGNSPLDRYIIEFKRSRASWSEIDRVIVPGHTTEAQV
QKLSPATTYNIRIVAENAIGTSQSSEAVTIITAEEAPSGKPQNIKVEPVNQTTMRVTW
KPPPRTEWNGEILGYYVGYKLSNTNSSYVFETINFITEEGKEHNLELQNLRVYTQYSV
VIQAFNKIGAGPLSEEEKQFTAEGTPSQPPSDTACTTLTSQTIRVGWVSPPLESANGV
IKTYKVVYAPSDEWYDETKRHYKKTASSDTVLHGLKKYTNYTMQVLATTAGGDGVRSV
PIHCQTEPDVPEAPTDVKALVMGNAAILVSWRPPAQPNGIITQYTVYSKAEGAETETK
TQKVPHYQMSFEATELEKNKPYEFWVTASTTIGEGQQSKSIVAMPSDQVPAKIASFDD
TFTATFKEDAKMPCLAVGAPQPEITWKIKGVEFSANDRMRVLPDGSLLIKSVNRQDAG
DYSCHAENSIAKDSITHKLIVLAPPQSPHVTLSATTTDALTVKLKPHEGDTAPLHGYT
LHYKPEFGEWETSEVSVDSQKHNIEGLLCGSRYQVYATGFNNIGAGEASDILNTRTKG
QKPKLPEKPRFIEVSSNSVSLHFKAWKDGGCPMSHFVVESKKRDQIEWNQISNNVKPD
NNYVVLDLEPATWYNLRITAHNSAGFTVAEYDFATLTVTGGTIAPSRDLPELSAEDTI
RIILSNLNLVVPVVAALLVIIIAIIVICILRSKGNHHKDDVVYNQTMGPGATLDKRRP
DLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRGRGGLRSNHSTWDPRRNPNLYEELKA
PPVPMHGNHYGHAHGNAECHYRHPGMEDEICPYATFHLLGFREEMDPTKAMNFQTFPH
QNGHAGPVPGHAGTMLPPGHPGHVHSRSGSQSMPRANRYQRKNSQGGQSSIYTPAPEY
DDPANCAEEDQYRRYTRVNSQGGSLYSGPGPEYDDPANCAPEEDQYGSQYGGPYGQPY
DHYGSRGSMGRRSIGSARNPGNGSPEPPPPPPRNHDMSNSSFNDSKESNEISEAECDR
DHGPRGNYGAVKRSPQPKDQRTTEEMRKLIERNETGPKQLQLQQANGAGFTAYDTMAV
"
misc_feature 688..903
/gene="Dscam"
/note="Region: smart00409, IG, Immunoglobulin"
misc_feature 688..891
/gene="Dscam"
/note="Region: smart00408, IGc2, Immunoglobulin C-2 Type"
misc_feature 1309..1506
/gene="Dscam"
/note="Region: smart00408, IGc2, Immunoglobulin C-2 Type"
misc_feature 1324..1539
/gene="Dscam"
/note="Region: smart00409, IG, Immunoglobulin"
misc_feature 1564..1782
/gene="Dscam"
/note="Region: smart00409, IG, Immunoglobulin"
misc_feature 1588..1746
/gene="Dscam"
/note="Region: smart00408, IGc2, Immunoglobulin C-2 Type"
misc_feature 1588..1740
/gene="Dscam"
/note="Region: pfam00047, ig, Immunoglobulin domain.
Members of the immunoglobulin superfamily are found in
hundreds of proteins of different functions. Examples
include antibodies, the giant muscle kinase titin and
receptor tyrosine kinases. Immunoglobulin-like domains may
be involved in protein-protein and protein-ligand
interactions. The Pfam alignments do not include the first
and last strand of the immunoglobulin-like domain"
misc_feature 1825..2091
/gene="Dscam"
/note="Region: smart00409, IG, Immunoglobulin"
misc_feature 1840..2058
/gene="Dscam"
/note="Region: smart00408, IGc2, Immunoglobulin C-2 Type"
misc_feature 1846..2043
/gene="Dscam"
/note="Region: pfam00047, ig, Immunoglobulin domain.
Members of the immunoglobulin superfamily are found in
hundreds of proteins of different functions. Examples
include antibodies, the giant muscle kinase titin and
receptor tyrosine kinases. Immunoglobulin-like domains may
be involved in protein-protein and protein-ligand
interactions. The Pfam alignments do not include the first
and last strand of the immunoglobulin-like domain"
misc_feature 2128..2361
/gene="Dscam"
/note="Region: smart00409, IG, Immunoglobulin"
misc_feature 2137..2328
/gene="Dscam"
/note="Region: smart00408, IGc2, Immunoglobulin C-2 Type"
misc_feature 2137..2313
/gene="Dscam"
/note="Region: pfam00047, ig, Immunoglobulin domain.
Members of the immunoglobulin superfamily are found in
hundreds of proteins of different functions. Examples
include antibodies, the giant muscle kinase titin and
receptor tyrosine kinases. Immunoglobulin-like domains may
be involved in protein-protein and protein-ligand
interactions. The Pfam alignments do not include the first
and last strand of the immunoglobulin-like domain"
misc_feature 2407..2652
/gene="Dscam"
/note="Region: smart00409, IG, Immunoglobulin"
misc_feature 2680..2928
/gene="Dscam"
/note="Region: smart00409, IG, Immunoglobulin"
misc_feature 2701..2910
/gene="Dscam"
/note="Region: smart00408, IGc2, Immunoglobulin C-2 Type"
misc_feature 2704..2895
/gene="Dscam"
/note="Region: pfam00047, ig, Immunoglobulin domain.
Members of the immunoglobulin superfamily are found in
hundreds of proteins of different functions. Examples
include antibodies, the giant muscle kinase titin and
receptor tyrosine kinases. Immunoglobulin-like domains may
be involved in protein-protein and protein-ligand
interactions. The Pfam alignments do not include the first
and last strand of the immunoglobulin-like domain"
misc_feature 2974..3243
/gene="Dscam"
/note="Region: smart00409, IG, Immunoglobulin"
misc_feature 2995..3210
/gene="Dscam"
/note="Region: smart00408, IGc2, Immunoglobulin C-2 Type"
misc_feature 2995..3195
/gene="Dscam"
/note="Region: pfam00047, ig, Immunoglobulin domain.
Members of the immunoglobulin superfamily are found in
hundreds of proteins of different functions. Examples
include antibodies, the giant muscle kinase titin and
receptor tyrosine kinases. Immunoglobulin-like domains may
be involved in protein-protein and protein-ligand
interactions. The Pfam alignments do not include the first
and last strand of the immunoglobulin-like domain"
misc_feature 3250..3501
/gene="Dscam"
/note="Region: smart00060, FN3, Fibronectin type 3 domain;
One of three types of internal repeat within the plasma
protein, fibronectin. The tenth fibronectin type III
repeat contains a RGD cell recognition sequence in a
flexible loop between 2 strands. Type III modules are
present in both extracellular and intracellular proteins"
misc_feature 3259..3510
/gene="Dscam"
/note="Region: pfam00041, fn3, Fibronectin type III
domain"
misc_feature 3550..3816
/gene="Dscam"
/note="Region: smart00060, FN3, Fibronectin type 3 domain;
One of three types of internal repeat within the plasma
protein, fibronectin. The tenth fibronectin type III
repeat contains a RGD cell recognition sequence in a
flexible loop between 2 strands. Type III modules are
present in both extracellular and intracellular proteins"
misc_feature 3556..3825
/gene="Dscam"
/note="Region: pfam00041, fn3, Fibronectin type III
domain"
misc_feature 3868..4119
/gene="Dscam"
/note="Region: smart00060, FN3, Fibronectin type 3 domain;
One of three types of internal repeat within the plasma
protein, fibronectin. The tenth fibronectin type III
repeat contains a RGD cell recognition sequence in a
flexible loop between 2 strands. Type III modules are
present in both extracellular and intracellular proteins"
misc_feature 3871..4128
/gene="Dscam"
/note="Region: pfam00041, fn3, Fibronectin type III
domain"
misc_feature 4162..4410
/gene="Dscam"
/note="Region: smart00060, FN3, Fibronectin type 3 domain;
One of three types of internal repeat within the plasma
protein, fibronectin. The tenth fibronectin type III
repeat contains a RGD cell recognition sequence in a
flexible loop between 2 strands. Type III modules are
present in both extracellular and intracellular proteins"
misc_feature 4171..4419
/gene="Dscam"
/note="Region: pfam00041, fn3, Fibronectin type III
domain"
misc_feature 4501..4719
/gene="Dscam"
/note="Region: smart00409, IG, Immunoglobulin"
misc_feature 4501..4683
/gene="Dscam"
/note="Region: smart00408, IGc2, Immunoglobulin C-2 Type"
misc_feature 4501..4671
/gene="Dscam"
/note="Region: pfam00047, ig, Immunoglobulin domain.
Members of the immunoglobulin superfamily are found in
hundreds of proteins of different functions. Examples
include antibodies, the giant muscle kinase titin and
receptor tyrosine kinases. Immunoglobulin-like domains may
be involved in protein-protein and protein-ligand
interactions. The Pfam alignments do not include the first
and last strand of the immunoglobulin-like domain"
misc_feature 4723..4965
/gene="Dscam"
/note="Region: smart00060, FN3, Fibronectin type 3 domain;
One of three types of internal repeat within the plasma
protein, fibronectin. The tenth fibronectin type III
repeat contains a RGD cell recognition sequence in a
flexible loop between 2 strands. Type III modules are
present in both extracellular and intracellular proteins"
misc_feature 4741..4974
/gene="Dscam"
/note="Region: pfam00041, fn3, Fibronectin type III
domain"
misc_feature 5008..5250
/gene="Dscam"
/note="Region: smart00060, FN3, Fibronectin type 3 domain;
One of three types of internal repeat within the plasma
protein, fibronectin. The tenth fibronectin type III
repeat contains a RGD cell recognition sequence in a
flexible loop between 2 strands. Type III modules are
present in both extracellular and intracellular proteins"
misc_feature 5017..5253
/gene="Dscam"
/note="Region: pfam00041, fn3, Fibronectin type III
domain"
BASE COUNT 2081 a 2155 c 1877 g 1586 t
ORIGIN
1 agaaccggat ttcagcgcta gtcggcgaat cgcgagagcg tgcgagtatt tgtgtgtgcg
61 tgtgagcgtt tgttttggga caccgatacg gatacgggta cggatagacg gatatacggc
121 agcggtacgc gattagcaat ccgccaaccg gttgcagcgg tgctagtgca ccaccctaca
181 aaaaagtgaa taatagtatg caaagtatct gaaagatagt caagagcaga gcaaagtatc
241 tgtgtttgtg tgtgccgtgc ttttgtgcgg agtcgccacc cccgtggatt agtggcaccc
301 tgctgcaaat agcccaccac tctcacaagt gtgtgtgtgt gagtgttaac aattaatcgc
361 atttaaaaaa caatttggcc agccgcagta acaataacga taattcggac gtgccaaggg
421 tgcttttcag tggatttttg cgtaaaatcg atagtcagat agacccgctc tctactgcca
481 acttcacaca acccgctcag cggaaacacg gcatacgaaa tgaatatgcc caacgaacgc
541 ctcaaatggc taatgctgtt cgcagctgtt gccctcattg cttgtggtag tcagacccta
601 gctgccaatc ccccagatgc cgaccaaaaa ggacccgtct tcctcaagga acccaccaac
661 cgcattgact tctccaactc cacgggcgca gagatcgagt gcaaggccag cggcaatccc
721 atgcccgaga ttatttggat caggagcgac ggtaccgccg tgggtgatgt gcccggattg
781 cgtcagatct catccgacgg caagctggtc ttccctccat tccgcgccga ggactaccgc
841 caggaggtcc atgcccaggt gtacgcctgc ctggcccgca accagttcgg atccattatc
901 tcccgggacg tccatgtgcg agccgtggtt gcccagtact acgaggcgga tgttaacaag
961 gagcacgtta taagaggcaa ttcggcggtc atcaagtgtc tgattccatc cttcgtggcc
1021 gatttcgtcg aagtggtgtc ctggcacacc gatgaggagg agaactactt tccgggcgcg
1081 gaatacgatg gaaagtacct ggtattgccc tctggagagc tgcacatccg tgaggttgga
1141 cccgaggacg gatacaagag ctaccagtgc cgaaccaaac atcgtctgac cggagaaacc
1201 cgattaagtg ccacaaaagg acgattggtc atcacagagc ccgttagcag tagtccgccc
1261 aaaatcaatg ctctgaccta taagcccaat attgtggagt ccatggcgtc caccgcaata
1321 ctttgtcccg cccaaggcta tccagctcct agttttagat ggtacaagtt catcgaagga
1381 acaacccgta aacaagctgt ggtgctaaat gaccgtgtga agcaggtctc tggtactctc
1441 attattaagg acgcagtagt cgaggactcc ggaaaatacc tgtgcgtggt gaacaattcc
1501 gtgggaggcg aaagcgttga gactgtgctt accgtcactg cccccctatc cgctaagatc
1561 gatcctccca cacagacagt tgacttcgga cgccccgccg tattcacttg ccagtacact
1621 ggaaatccca tcaagaccgt tagctggatg aaggacggca aggctatcgg acacagcgaa
1681 cccgtgctgc gcatcgaatc cgtgaagaag gaggacaagg gcatgtacca gtgcttcgta
1741 agaaacgacc aggaatcggc ggaggcgagt gctgagctga agctcggagg ccgtttcgat
1801 ccccccgtca tccgacaggc cttccaggaa gagaccatgg aacccggacc aagtgtattc
1861 ctcaagtgcg tcgccggcgg aaaccccacg cccgaaattt cctgggaact cgacggcaag
1921 aaaatcgcca acaacgatcg ctatcaggtc ggacagtatg tgacggtcaa cggagatgtg
1981 gtttcctatc tgaacataac ctcggtccac gccaacgatg gcggtctcta caagtgcata
2041 gccaagagca aagtgggcgt ggccgaacac tcggccaagt tgaatgtata tggactgccc
2101 tacatccggc aaatggagaa gaaggcaatt gttgctggag aaaccctgat tgtcacatgt
2161 cctgtagctg gataccccat cgattcgatt gtctgggagc gagataaccg tgccctgccc
2221 atcaaccgca aacagaaggt cttccccaac ggaacgctga ttatcgagaa tgtggaacgg
2281 aactcagacc aagcgaccta cacttgcgtt gccaagaatc aggaaggata ctctgctcga
2341 ggatctctgg aagtgcaagt catggtgccg ccccaggttt tgccctttag tttcggtgaa
2401 tccgccgccg atgtcggcga tattgccagt gccaactgtg tggtgcccaa gggagatctg
2461 cccctggaga ttcgctggtc cctcaactct gctccaatcg taaacggcga aaatgggttt
2521 accctggtgc gtctgaataa gcgcacgagt ctgttaaaca ttgattctct aaatgctttt
2581 catcgcggtg tctacaagtg catagccaca aatccggctg ggaccagtga atatgtagct
2641 gaattacaag ttaatgtacc tcccagatgg atcctcgagc ccaccgataa ggccttcgcc
2701 cagggatccg atgccaaggt tgaatgcaag gctgatggct tccccaaacc ccaagttaca
2761 tggaagaaag cagttggcga cacccccgga gagtacaagg atctaaagaa gagcgacaac
2821 atccgcgtgg aagagggcac tctgcatgtc gacaacatcc aaaagaccaa cgagggctac
2881 tatctgtgcg aggctatcaa tggaataggc tccggcctct cggctgtgat tatgatcagc
2941 gttcaggccc ctccagagtt cacggagaag ctgcgcaacc agaccgcccg acgaggagaa
3001 cccgccgtac tccagtgcga ggcgaagggc gagaagccca ttggcatctt gtggaacatg
3061 aacaacatgc gactggaccc aaagaacgac aatcggtaca ccattcgtga ggagatcctt
3121 tccaccggag ttatgtccag tctgtcgatc aagcgcaccg agagatccga ctccgcccta
3181 ttcacctgtg tcgccactaa tgcctttgga tccgatgacg ccagcataaa tatgattgtc
3241 caggaagttc cggagatgcc atatgctttg aaggtactcg acaaatccgg acgttccgtg
3301 cagctgagct gggcgcaacc ctacgatggc aactcccctc tggacaggta catcattgag
3361 tttaagcgtt ctcgtgcctc ctggagcgaa attgatcgcg tcatcgtgcc cggacacacc
3421 acagaagccc aagtgcagaa gctcagcccc gccaccacct acaacattcg catcgtggcc
3481 gaaaacgcca tcggcacatc ccaatcctct gaagcggtca ctatcatcac agccgaagaa
3541 gcaccctccg gcaagcccca gaacatcaag gtagaacccg tgaaccagac caccatgcgc
3601 gtcacctgga agccaccacc acgcaccgag tggaacggag agatcctggg ctactacgtc
3661 ggctacaagc tatccaacac taactcgtcc tacgttttcg agaccatcaa cttcatcacc
3721 gaggagggca aggagcacaa cctggaactg cagaacctgc gcgtgtacac ccagtactcc
3781 gtggtgatcc aggccttcaa caagatcgga gctggtccac tgagcgaaga ggagaaacaa
3841 ttcacggccg agggaacgcc cagccagcca cccagtgaca ccgcctgcac caccttaact
3901 tcgcagacca ttcgcgtcgg atgggtgagc ccacccctgg aatccgccaa cggagtgatc
3961 aagacctata aggttgtcta tgcccccagt gacgagtggt atgacgagac caagcgacac
4021 tataagaaga cggcctcctc cgacacagtc ctccatggct taaagaagta caccaactac
4081 acaatgcagg tcctggccac aacagccgga ggcgatggcg tccgcagcgt tcccatccac
4141 tgccaaaccg aacccgatgt tcccgaagca cccactgatg taaaggctct tgttatgggt
4201 aacgccgcta tcctggtatc ctggcgccca ccagcacagc caaacggcat tatcacccag
4261 tacaccgtgt actccaaggc cgaaggcgct gagactgaga caaagaccca gaaggttccc
4321 cactaccaga tgagtttcga ggccaccgaa ctggagaaga acaagcccta cgagttctgg
4381 gtgacagcta gcaccaccat tggcgaaggc cagcagtcta agagcatagt ggccatgccc
4441 agcgaccagg tgcccgccaa gatcgcctcc ttcgacgaca ccttcactgc caccttcaag
4501 gaggacgcca agatgccctg cctggccgtt ggagcccccc aacccgagat cacatggaag
4561 atcaagggcg tcgaattcag tgccaacgat cgcatgcgcg tcctccccga cggatcgctg
4621 ctgatcaagt cggtaaatcg ccaggatgcc ggagactact cctgccacgc cgagaactcg
4681 attgctaagg actccatcac gcacaaactg attgttctgg caccaccaca atcgccccac
4741 gtcaccctct cggcaaccac cactgatgcc ctgactgtaa agttgaagcc ccatgaggga
4801 gacactgctc ctctgcatgg atacaccctg cactacaagc cagaattcgg agaatgggaa
4861 acatcggaag tgtctgtcga ctcacagaag cacaacatcg aaggtctctt gtgcggctcc
4921 cgctatcagg tctatgccac aggattcaat aacattggag ctggcgaagc ttctgacatt
4981 ttgaacaccc ggaccaaggg acagaagccc aagctgcccg agaaacctcg cttcattgaa
5041 gtgtcgtcca actcggtgtc cctgcacttc aaggcctgga aagatggagg atgccccatg
5101 tcgcactttg tggtggagag caagaagcgc gatcaaattg agtggaacca aatttcgaac
5161 aacgtgaagc ccgataacaa ctacgtggtt ttggacctgg aacccgccac ctggtacaac
5221 ctccgcatca ctgcccacaa ctcggctggc ttcactgtgg ccgaatacga ctttgccacc
5281 ttaaccgtta ccggaggcac tatcgcaccc tcgcgagatt tacccgagtt aagcgccgag
5341 gacacgatcc gcattatcct ctcgaaccta aacttagttg tgcccgtcgt ggcggctctg
5401 ctcgtcataa tcatagcgat aattgttatt tgtatactgc gtagcaaggg caatcaccac
5461 aaagacgatg tagtttacaa tcagacaatg ggacccggcg ccaccctgga caagcgtcgt
5521 ccggacctgc gggatgagct cggatacatc gccccgccca accggaagct gccccccgtt
5581 cccggatcca actataatac ctgtgaccgg attaagcgag gccgcggtgg cctccggtcc
5641 aaccactcga cctgggaccc tcgacgcaat cccaacctgt acgaggagct gaaggccccg
5701 ccagtgccga tgcacggcaa ccattacggc cacgcccacg gcaatgccga gtgccactac
5761 aggcatccag gcatggaaga tgaaatctgc ccctatgcca cgttccacct gctcggattc
5821 cgcgaggaaa tggaccctac caaggccatg aacttccaga ccttccccca ccagaacgga
5881 cacgccggcc cagttcccgg acacgcgggc actatgcttc caccaggaca tccaggacac
5941 gtgcactccc gctccggatc gcaatcgatg cctcgggcca atcgatacca gcgaaagaac
6001 agccagggcg gacagtcctc aatctacacg ccagctcccg aatacgatga tcccgccaac
6061 tgtgccgaag aggaccaata tcgtcgatac acccgcgtca actcgcaagg cggtagcctg
6121 tactccggac ccggacccga atacgacgat cccgccaact gcgcacccga agaggatcag
6181 tacggctccc agtacggagg accctatgga cagccctatg atcactacgg ttcccgggga
6241 tccatgggac gtcgtagcat cggctctgct cgcaatcctg gcaatggatc acccgagcct
6301 ccaccaccac caccacgcaa ccacgacatg agcaactcct cattcaacga ctccaaggag
6361 agtaatgaga tctcagaggc agagtgcgat cgtgaccacg gaccacgcgg aaactacgga
6421 gcagtgaagc gatctccaca accgaaagat cagcgcacca ccgaagaaat gcgcaaactg
6481 atagaaagaa acgaaaccgg cccaaaacaa ctccaactcc aacaagcaaa tggcgcagga
6541 ttcacagcct acgatactat ggcagtgtaa tttgtaagcg ccctctgcgg cggtgggcgt
6601 ggcattttag cttagtgttt taggtgcatg aagtgcgtgg gagttgaatg acacttagag
6661 acacaggaca cagatacaca cagacagatc atcaggacac aaggaaagag atagagaaag
6721 agagggagtt atataccgaa tatacacgta aaatattcaa ctacttcgag taattatagc
6781 gaaggaatgc aagtttcaag aaacatattt atattgtcta tgcaagcagc aaaccaaact
6841 tacataaagt atataagtac attcaatgga taactactat aagagagtgc tggagacact
6901 gaaggaaatt actcaagtta ttcgagagga acagaaaacg aaatctcaag atcaagatca
6961 tacttacgta ttcgaactaa ttttcaataa tgtactttag ttttaagcgg tgtctaccga
7021 aatatcagag caacagcaac tgagatggat tcttgtgtgt aagaggagat gattcgaaat
7081 ctgtttgtgt aaacttttgc catctatgcc aggagcagaa aactcatcct ttgcctagcc
7141 taagtcaaag tcataatatt aactcgtcta attgatatat ttagtcgtaa catatgcgta
7201 atatgtatga tttcttccta tgcattttat aattcgtatg gacagcgcac atttggagtt
7261 ttgtttgcgt tttgcgttga cttgtgatga ttgttaattt acagagcttt gtgagtgagt
7321 acttacgatt gtgctcatta ctcgctttgt tctttattta cagacaagtg attgtcctat
7381 cttagttcgc ccttattttt aattcaaaaa tgcgcttcca acagaacaaa tcgaaactgt
7441 tcaatgcaca aatcgcagcc acaacaattg aatgtattat acaagatccc caggacaccg
7501 aaaaaccaaa acccctaacc cgaaacacag atacactcaa gcacgattta ttaaaccaat
7561 tctgatatag accgttctga acatgagtta tacgcatttg aagctttaag agaacctgaa
7621 attgtttatt tcacttcatt tgatctatcc taagttatta gttcataagt tgctaaatat
7681 atgattttga ttttatttt
//
Aug 28 2002 15:52:55
Links