¡€0€ €0€ €0€ €Ò¡€0€ €T079£€0€¢€0€ €Protein Data Bank¡€ €¡€0€ €Ρ€ ¢€¢€¡€0€ €PDB¡€¡€T079£€¡€0€ €Ρ€¢€€€¡€0€ €0€ €¢€0€S.Rhee R.G.Martin J.L.Rosner D.R.Davies¡€0€ €¡€0€ €Ρ€¢€¢€0€ €0€ €¡€&Transcriptional Activator; A Bipartite¢€NA§€ÿ¡€0€0€ €¡€0€ € £€SEQRESš€¢€ €¡€T079 0£€0€0€ €¡€ ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€'0€ €¡€ ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€10€ €¡€ ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€%0€ €¡€ ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €¡€ ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€10€ € ¡€ 9 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€ 0€ € ¡€ 10 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ € ¡€ 11 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ € ¡€ 12 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€10€ € ¡€ 13 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 14 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 15 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €¡€ 16 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 17 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 18 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€ 0€ €¡€ 19 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€40€ €¡€ 20 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 21 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 22 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€ 0€ €¡€ 23 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 24 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 25 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 26 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €¡€ 27 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€+0€ €¡€ 28 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 29 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €¡€ 30 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 31 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ € ¡€ 32 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €!¡€ 33 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€:0€ €"¡€ 34 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €#¡€ 35 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €$¡€ 36 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €%¡€ 37 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €&¡€ 38 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €'¡€ 39 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€70€ €(¡€ 40 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €)¡€ 41 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €*¡€ 42 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€40€ €+¡€ 43 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €,¡€ 44 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €-¡€ 45 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €.¡€ 46 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €/¡€ 47 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€%0€ €0¡€ 48 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€(0€ €1¡€ 49 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €2¡€ 50 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €3¡€ 51 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €4¡€ 52 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€10€ €5¡€ 53 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €6¡€ 54 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €7¡€ 55 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €8¡€ 56 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €9¡€ 57 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €:¡€ 58 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €;¡€ 59 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€70€ €<¡€ 60 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €=¡€ 61 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €>¡€ 62 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €?¡€ 63 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €@¡€ 64 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €A¡€ 65 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€%0€ €B¡€ 66 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€10€ €C¡€ 67 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €D¡€ 68 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €E¡€ 69 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €F¡€ 70 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €G¡€ 71 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €H¡€ 72 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €I¡€ 73 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €J¡€ 74 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €K¡€ 75 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €L¡€ 76 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €M¡€ 77 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €N¡€ 78 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€+0€ €O¡€ 79 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €P¡€ 80 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €Q¡€ 81 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€70€ €R¡€ 82 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €S¡€ 83 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €T¡€ 84 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €U¡€ 85 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €V¡€ 86 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€70€ €W¡€ 87 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €X¡€ 88 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€(0€ €Y¡€ 89 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €Z¡€ 90 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €[¡€ 91 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €\¡€ 92 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €]¡€ 93 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€10€ €^¡€ 94 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €_¡€ 95 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€10€ €`¡€ 96 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €a¡€ 97 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€10€ €b¡€ 98 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€(0€ €c¡€ 99 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €d¡€ 100 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €e¡€ 101 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€70€ €f¡€ 102 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€(0€ €g¡€ 103 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€ 0€ €h¡€ 104 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€:0€ €i¡€ 105 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€+0€ €j¡€ 106 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€+0€ €k¡€ 107 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €l¡€ 108 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €m¡€ 109 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€70€ €n¡€ 110 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €o¡€ 111 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€%0€ €p¡€ 112 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€10€ €q¡€ 113 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €r¡€ 114 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€%0€ €s¡€ 115 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €t¡€ 116 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €u¡€ 117 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €v¡€ 118 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €w¡€ 119 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €x¡€ 120 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€(0€ €y¡€ 121 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €z¡€ 122 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €{¡€ 123 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€+0€ €|¡€ 124 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €}¡€ ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €~¡€ ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€70€ €€¡€ ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€/€€0€0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€ ¢€ 0€ €0€ €¡€ ¢€¡€0€ €¡€ ¢€0€ €0€ €¡€ ¢€¡€0€ €¡€ ¢€ 0€ €0€ €¡€ ¢€¡€0€ €¡€ ¢€ 0€ €0€ €¡€ ¢€¡€0€ €¡€ ¢€ 0€ €0€ €¡€ ¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€ ¢€ 0€ €0€ €¡€ ¢€¡€0€ €¡€!¢€ 0€ €0€ €¡€!¢€¡€0€ €¡€"¢€0€ €0€ €¡€"¢€¡€0€ €¡€#¢€ 0€ €0€ €¡€#¢€¡€0€ €¡€$¢€ 0€ €0€ €¡€$¢€¡€0€ €¡€%¢€0€ €0€ €¡€%¢€¡€0€ €¡€&¢€0€ €0€ €¡€&¢€¡€0€ €¡€'¢€0€ €0€ €¡€'¢€¡€0€ €¡€(¢€0€ €0€ €¡€(¢€¡€0€ €¡€)¢€ 0€ €0€ €¡€)¢€¡€0€ €¡€*¢€0€ €0€ €¡€*¢€¡€0€ €¡€+¢€ 0€ €0€ €¡€+¢€¡€0€ €¡€,¢€ 0€ €0€ €¡€,¢€¡€0€ €¡€-¢€0€ €0€ €¡€-¢€¡€0€ €¡€.¢€ 0€ €0€ €¡€.¢€¡€0€ €¡€/¢€0€ €0€ €¡€/¢€¡€0€ €¡€0¢€0€ €0€ €¡€0¢€¡€0€ €¡€1¢€ 0€ €0€ €¡€1¢€¡€0€ €¡€2¢€ 0€ €0€ €¡€2¢€¡€0€ €¡€3¢€ 0€ €0€ €¡€3¢€¡€0€ €¡€4¢€ 0€ €0€ €¡€4¢€¡€0€ €¡€5¢€0€ €0€ €¡€5¢€¡€0€ €¡€6¢€ 0€ €0€ €¡€6¢€¡€0€ €¡€7¢€0€ €0€ €¡€7¢€¡€0€ €¡€8¢€ 0€ €0€ €¡€8¢€¡€0€ €¡€9¢€0€ €0€ €¡€9¢€¡€0€ €¡€:¢€0€ €0€ €¡€:¢€¡€0€ €¡€;¢€0€ €0€ €¡€;¢€¡€0€ €¡€<¢€ 0€ €0€ €¡€<¢€¡€0€ €¡€=¢€ 0€ €0€ €¡€=¢€¡€0€ €¡€>¢€0€ €0€ €¡€>¢€¡€0€ €¡€?¢€ 0€ €0€ €¡€?¢€¡€0€ €¡€@¢€ 0€ €0€ €¡€@¢€¡€0€ €¡€A¢€0€ €0€ €¡€A¢€¡€0€ €¡€B¢€ 0€ €0€ €¡€B¢€¡€0€ €¡€C¢€ 0€ €0€ €¡€C¢€¡€0€ €¡€D¢€ 0€ €0€ €¡€D¢€¡€0€ €¡€E¢€0€ €0€ €¡€E¢€¡€0€ €¡€F¢€0€ €0€ €¡€F¢€¡€0€ €¡€G¢€ 0€ €0€ €¡€G¢€¡€0€ €¡€H¢€ 0€ €0€ €¡€H¢€¡€0€ €¡€I¢€ 0€ €0€ €¡€I¢€¡€0€ €¡€J¢€ 0€ €0€ €¡€J¢€¡€0€ €¡€K¢€0€ €0€ €¡€K¢€¡€0€ €¡€L¢€0€ €0€ €¡€L¢€¡€0€ €¡€M¢€ 0€ €0€ €¡€M¢€¡€0€ €¡€N¢€0€ €0€ €¡€N¢€¡€0€ €¡€O¢€ 0€ €0€ €¡€O¢€¡€0€ €¡€P¢€ 0€ €0€ €¡€P¢€¡€0€ €¡€Q¢€0€ €0€ €¡€Q¢€¡€0€ €¡€R¢€ 0€ €0€ €¡€R¢€¡€0€ €¡€S¢€0€ €0€ €¡€S¢€¡€0€ €¡€T¢€ 0€ €0€ €¡€T¢€¡€0€ €¡€U¢€ 0€ €0€ €¡€U¢€¡€0€ €¡€V¢€0€ €0€ €¡€V¢€¡€0€ €¡€W¢€0€ €0€ €¡€W¢€¡€0€ €¡€X¢€0€ €0€ €¡€X¢€¡€0€ €¡€Y¢€ 0€ €0€ €¡€Y¢€¡€0€ €¡€Z¢€0€ €0€ €¡€Z¢€¡€0€ €¡€[¢€0€ €0€ €¡€[¢€¡€0€ €¡€\¢€0€ €0€ €¡€\¢€¡€0€ €¡€]¢€ 0€ €0€ €¡€]¢€¡€0€ €¡€^¢€ 0€ €0€ €¡€^¢€¡€0€ €¡€_¢€ 0€ €0€ €¡€_¢€¡€0€ €¡€`¢€ 0€ €0€ €¡€`¢€¡€0€ €¡€a¢€ 0€ €0€ €¡€a¢€¡€0€ €¡€b¢€0€ €0€ €¡€b¢€¡€0€ €¡€c¢€ 0€ €0€ €¡€c¢€¡€0€ €¡€d¢€0€ €0€ €¡€d¢€¡€0€ €¡€e¢€0€ €0€ €¡€e¢€¡€0€ €¡€f¢€0€ €0€ €¡€f¢€¡€0€ €¡€g¢€ 0€ €0€ €¡€g¢€¡€0€ €¡€h¢€ 0€ €0€ €¡€h¢€¡€0€ €¡€i¢€0€ €0€ €¡€i¢€¡€0€ €¡€j¢€0€ €0€ €¡€j¢€¡€0€ €¡€k¢€ 0€ €0€ €¡€k¢€¡€0€ €¡€l¢€ 0€ €0€ €¡€l¢€¡€0€ €¡€m¢€0€ €0€ €¡€m¢€¡€0€ €¡€n¢€ 0€ €0€ €¡€n¢€¡€0€ €¡€o¢€0€ €0€ €¡€o¢€¡€0€ €¡€p¢€ 0€ €0€ €¡€p¢€¡€0€ €¡€q¢€0€ €0€ €¡€q¢€¡€0€ €¡€r¢€0€ €0€ €¡€r¢€¡€0€ €¡€s¢€0€ €0€ €¡€s¢€¡€0€ €¡€t¢€0€ €0€ €¡€t¢€¡€0€ €¡€u¢€ 0€ €0€ €¡€u¢€¡€0€ €¡€v¢€0€ €0€ €¡€v¢€¡€0€ €¡€w¢€ 0€ €0€ €¡€w¢€¡€0€ €¡€x¢€0€ €0€ €¡€x¢€¡€0€ €¡€y¢€ 0€ €0€ €¡€y¢€¡€0€ €¡€z¢€ 0€ €0€ €¡€z¢€¡€0€ €¡€{¢€0€ €0€ €¡€{¢€¡€0€ €¡€|¢€ 0€ €0€ €¡€|¢€¡€0€ €¡€}¢€0€ €0€ €¡€}¢€¡€0€ €¡€~¢€ 0€ €0€ €¡€~¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€€¢€0€ €0€ €¡€€¢€¡€0€ €¡€¢€£€0€0€ €¡€0€ €!NCBI assigned secondary structure¢€0€0€ €¡€helix 1¢€€€ €¡€¡€0€0€ €¡€ ¢€0€ €¡€helix 2¢€€€ €¡€¡€0€0€ €¡€)¢€30€ €¡€helix 3¢€€€ €¡€¡€0€0€ €¡€8¢€J0€ €¡€helix 4¢€€€ €¡€¡€0€0€ €¡€O¢€V0€ €¡€helix 5¢€€€ €¡€¡€0€0€ €¡€[¢€e0€ €¡€helix 6¢€€€ €¡€¡€0€0€ €¡€i¢€p0€ €¡€0€ € NCBI Domains¢€0€0€ €¡€Domain¢€d€€ €¡€¡€0€0€ €¡€6¢€€€0€0€ €¡€¢€0€ €QSingle-coordinate-per-atom model from PDB entry T079 with a vector model attached¡€Resolution: 2.3£€ NA NA £€0€ € ¡€ €€0€0€ €¢€ € €0€ €Ρ€0€ €Ρ€0€¢€0€                                             !!!!!!!""""""#########$$$$$$$$$$$%%%%%%&&&&''''''''''''(((((()))))))))**************++++++++++,,,,,,,,---------...........////////00000000000111111111222222222333333333444444455556666666666777777888888889999:::::::::;;;;;;;;;;;;<<<<<<<<===========>>>>>>???????????@@@@@@@@@AAAAAAAABBBBBBBCCCCCCCCCDDDDDDDDEEEEEFFFFFFFFFGGGGGGGGGHHHHHHHHIIIIIIIIIJJJJJJJJJKKKKKKLLLLLLLLMMMMMMMMMNNNNNNNOOOOOOOOPPPPPPPPQQQQQQQQQQQQRRRRRRRRSSSSSTTTTTTTTTUUUUUUUUUUUVVVVVVVVVVVVWWWWXXXXXXXXXXXYYYYYYYYYZZZZZZ[[[[[[[[[\\\\\\\\\]]]]]]]^^^^^^^^_______```````````aaaaaaabbbbbbbbbbbcccccccccddddddddeeeeeeeeeeeefffffffffffgggggggghhhhhhhiiiiiiijjjjjjjkkkkkkkkkklllllllllmmmmmmmmmmmmnnnnnnnnnnnoooooooopppppppqqqqqqqqrrrrrrrrsssssssssttttuuuuuuuuuvvvvvvwwwwwwwwwwwxxxxxxxxxxxyyyyyyyyzzzzzzzzzz{{{{{{{||||||||£€0€                                                                                                                                                                                                                                                         ¢€0€ €血0€å) üIÉo˜ 2ü ýücÂú'ô²ñŸîšñÈëéòÓèžòbïò%ïŠï ìÕôh÷Túùøˆ ]èÿù÷þò”ñqøŽþ ^¶pïIê éØè*æ\áöë}ë×îì~ï?í!ôèçIñÌóßïQîà÷šý¡þâØëÝç ä"â”äYçwêçYâòߍáëßÞTÚÁÕjÜ.Ór׆àé×|àÞÜ-ç"ééç]ïqðòõ«ê‰êBä•ãBìŠñ²ö\÷éø€á8Û£ÙàÕ:ØÃ×Օ×CݪÜbߌÝVÜ­×l֗ÓÙä¥ç·ä°ã}í î&ðGò*ãfà{܂ÙòÝØ߯ÜyØèÝlÛåØ­Ù¢Ú ÒÙÐ#ÚMÛàãºÛ-ÜØÚ¥ßðä„ç©ëçãݬ݄܃å—èXìÛñTêmç­ë–ïrð(ìÇíªè@èä#ônõ¥ñðúbþ1Zÿ$üî)éšå{ä.ç™äxçä*ÞÔãpßbáÝéÞ1ÛaÚÖæèè ç]íqîxèÎè ãhãhéMå²â­äóÝýßÙ€Ùg×_ÕÊÔòÏŸϬÍ1ʋÍeÛ`ÛYߨäjÛr׬ހâeã˜àèŠê€ëÎérïšïGîGðíúïÔîÐîaïwñGõ÷þôøðõOøŒþUø‚ùãùùôañ3){Q o¯p[5JíüèþŒù”úijÑ} þ‹ÿŸûÍþGþýp‰Dù$÷—÷%òyó Ïé ”Z =Ù‡kÖŒ»–>õ}‘ó  ø yž,ýûÛ & ãŸJŸe ‹É Ko£,êÓò"ã#ê(­(µ-€°‰˜Þf‚ÔM·[ vQbÍ@« ³á’ ÿ%ò%5(ï E˜[…4ÚÒ¬;Ð+!‘ ß ^ïìãýSW Ä  ' D1b%#à&]&)4  q@ S Ë íŽ­ŸÞûªþ?üpùªùzq± { Š   ɳD Ìœ à ˜‘a‡‰;Æð0{(ü!óþüù2þ+ûO÷)õxð‘îãT· f  ù Ž Ÿ¿  ²ŸÀ  , ç"üúÛø”÷°÷`òîóü$ûWþòý×ü ødý#ù X,Zp OÉÄüûDÿš*ÿwÐùôöGóÊðŽìÔécæÔè*ú|ü?ý÷þÙãüÃÿLHýmýÿb ûƒù“õÛð—ìÚôøøÁþI ÔðUëvìgðºè è$è%è…å¶äùæäê<éîžäMáÒåéšámÝnޖßôÞâÿååèkæ)áçܵݹíïÂìãí›õlõÄ÷|û8éŽæªâ·á®ãŒâ¿ݗâ«àŒÜÏßmÜôÙÉ؄Ü>Ó²Û(ҋÖPÕ8ä\çGèÉèâì0ëuðœé£êëiæñç±ìŒâCÝVÛ²Ù÷ØûӝÏŽÑ4Ë(ÜDÚŽÞBÜ¢Ú¢؋ÜÞÞ ÚÚÖ܃ã)æZç2êoë›ë8éÿìé—ëžênêOäŒä~ç¡è`é`ì‘é#å‰ðpôUøÓógü4öŸû#êZçKç×å!èÛæUà_ÝÃÞHëdìðòí‹òóð©ôEùÜý6ó@ö4õCò!÷óú¿ËÔbÿhýŠ÷èôëöVþy­yûƒû¿ûßþźÐû•üàþøBó Te ºÄ ú“e‰ 'hM… É‹cgÿ . Ý þÉ\6 Æ fÙ ðf þWž"Ê'Í$Y%ð+”.É!I${%])z!Ä"=#j!e!™!õ$'{köÕßœDÝ#Ÿ%­)å,ž!ãõžéŽ*=.,š/Ì3”5µ5õ7'•%mÐ%#*~s£’› 4~ Ÿ Þ ñ’W î , = ô kˆ³°œPp‘xˆ!B%'³*³ÅþÛÚŒ¥"ˆéª  B ®üðùJõRô`òF#Œ-ÇŒ °-Üä  ß¹!ÅO8#.!¥ ;…(<,š+€,Š1589Š6)†'ï$Î ±$Œ&h+A*Û/Ý&ì$z"a!" #\"+»• q'“+-(I$ú.¶2)£'Ì"F )(u-R.â2Ù4²2Ö8HùÊá@lê(g÷"i;œw N•ŸiW• Ê f 3  l š ց%«ýÅüàÏð Ð ?¶JU–¢€0€Œ¬‹ñ‡ž…l‚Q†Á“☊š<›`š0›¶—Ú™‹œ|3—è˜>’ÂŽïí.‰Ì…»ˆ4Ó‘·ÿŒž‡Ž‚ê–y›U›=ž. 5¢FŸ §(¡Ëг——“”p•w’éŽ;Š7ŒyŠü…—€¬†b€J’ê•‚”Ÿ—1–Ä–ž˜“›-—4—šžº£;¢l§‘“;[‹˜Šý†÷‡Iê‚ŸeOzezRw댓ŠHÑŒ‰1„œ‡òƒœ’Å–K–ì—䛘#™Á™p—m–\–‘\1—™NŸµŸeŽ@‰2‡š‡æ„ôƒô…\†.„„J€A†ÅŒ¬‹{‰Št†f‡#Í“֓됛—J‚5~ytÙy} ybtÎr tZvÑ|S~,miæjçhÊdbá]2f•n,oƒk¶mIuxSf¹bãc,e]r\Vg]'aaP_™aœ]É_Ãd%hscC[ŸY€]Ø_ÎT·QRLGíIÔ_NcbhjÅe jG`äim…l)o’nÝt&ge f{hí_\(W{S(XdìeÝj¬j¥fŠldmOk>m|qökEnÚsos]tDwòvîrqçlsiJk[f‡bLbKgÖlâqŠlâvBq}v/zœ^­ZK\F` V#XY­[Ÿ\‚`ŠWåRmNõM¶L^XÈY ]Æ`HTOMKhHCG*K8BÙFßBÇ_ch®kæc9gqhk:ln i‡n%o>s¥m0qÚvºp³k%k«m­qTfvdI_œ`g[k&lÊr§u i™i'fŸa ]D^[XRtGyŽ}q€éznxax@~t|Œš€„9}$€<€T‚É‚ç…f…o{ã|2̓Pvßw6zgx„rŒ~ŸÖ‡WŠê€‚ ‚w€†‡ñU•Œ[‘––/ƒÅQޝ‘\bА:Š[ˆ-…›„…ƒ~3~\‡"Št»‰‘âŽ0yåu%v5x\p®qtœuµsÏvÒrûuÑrGzÛnælµp q?q„ttz;|ìsÊxÆw¹zŸs—|#|Â…ƒ$ˆ*Œðˆ‘ Œ¯‘r•í~~*}¿€yyºzqy–uÏz5y[~§tqq_k|iýkknRj"€k…‰lŒ†Ö‚≊sŒm§>•˜šØ›b‡t††ýˆÇ€gcy¹x”s…͆šŒiŽSƒ¶}œ{^y]”î—Wš——ǝ••“—©– ™ •Ԙɜ™å ë‘0^’D’ô‰Ž†ƒ‡å€Š“ç–œœ=ž—žä€'€?šŠj¥ šñ§ú­d  Ÿ¢ž3Ÿ¬›_˜h™Ežx›;™ôžàŸ/–ZïŽNâ¢Œ§p«è¯‘©¥mš\©®ˆ«³°®­±®±ˆµ‘³²³²Äª šC£ï¡Ù¥ð ^¢Rž-™%•ŽŸðœá˜VŸ1˜›“ď1Žã“©—c˜Ü•R’‹©‡„ƒ–ƒÄ†U‹ç‚gzpxÀ~xa vìw÷sŒu¶sqpjŠii:z1|#}Õ~€­„Óˆ”„ÍŒFˆ|Œ0ÏH€ø|,|CƒÕ‰R‹IwúsqMp\opÏorœqnÏlÌl»n,k?wÄ{Ÿ| }Ü€õ…œ‰°‘À‘Õ•žzuz¬uctô}6ƒ…Í…È‹<‹5é“@q_l_hdhßeatc0gókPi!p…kñsjq$\pXXØVSQZQ·N(U\$\©`ÜcpWjV©a™ehc—f”f%jœklhŸo-^™\\w]˜ViUŸW&WþWh[†[çazbJZT‚\¡eLjÃlcosnZt#v"w)jŸk¡iálÚh²iÆj@ecPf,g<][£UÃSœNœK}LøgLj2oÑqÙj—f†ožrhww~zšyžy‚:‚>‡œ‡£ŠWs¿s rjtfn]lŽn¹m/q­onBssžiàdØdÁ`‘vƒzú™‚°|†&€Š:„‰€ „‡ƒ†Š‡Šr ‰.’MŒx‘ ~|M}ø~ ~+{hv{~2,€Ì~ú€†Èˆ4‰|z;~êƒ0wu“zh~‚]…—Š`›zhyƒ†)‰€ŽD‚›…ž„FŠ˜ˆ‹ü‡‰ÖŽ[’š†ˆ^„b|¶w‘¯•öš–“c—“tš£—š›ž5”Y—û›Ê q”ö—æ™a•”Œ˜?i™ÙŸoŸÒ™¡–X™÷¡£pš§ÝŸŸŸ›@¬]±?±3±Zµÿ¶$·ÜŽs°á±®¯Ý¯³`°ñ²t©'¥Í©H«M¡!›º™€—Qšhª$­­«=Š•®›­K©2§`²=±µV·¶‡§æ£òŸœ¿¢cž%Æ™D™Ê–!”“úŽcì‰I„èˆùžMžêžà¡K€€ B§ê Pš€Cœœ=Ÿž–³–™~Z¢Š¥R£À¢l«¬Ã¯U¬°—®ð€*¢×¡Ÿ{§qš/ŠŽ¡Ÿ:›Â–ï£ô§î­kŠÝ£€0€!Œ'J*Ò.F)<$÷!§$ÿ)Ï,ä.82¿* *P+%.¶2%Õ&Ì"*&`.1,6h:i.!1M,?6g;H>ÑCx:ƒ8Ô?<\<?kAÓEv;ó;ø<Ç;iâe5m|g³h·kkecbüg^‡mo7txikh^cÛk!s¥x0}.tyv¬zárg~­ƒh…*‰‚цŋ°Œ‚U„7:ƒu„ˆ|(xÿz3|/shsäyxðyt+s}y€{ô}΀xpÁkèjliâl;h®iŽh b0_}i]gneœk¬`1Z”W&RÕY£UšW×XeY(YV?V!RXÜU8TtW‡XöZ­ZíWŸUJ`Ž`þc_W©TºNóK•V©UžMâH–FAíHŠDÏG#GxH‡HŽF«C^?K/LÇOTóY Xj]ÂE]BO>K?ŽFIý9j5Z3H2J2Î0•4¬8ä-›*˜-%8*3"V$×!ö3J6Ÿ:š9°3Q1}?C=AjB’G¿F9KL™H >m<€8ù99Ž<@|;B?8?98;;Ë5Ð2C5%4».)ò'([#Ô$—7à;)=ÿ>^?,B‘??E]?úB¶?@kDÓI:KÊN:K1:‰6’5t621l-Í(r(œ)I)p)¡3×2u6Î5ò1F,,.ê;r@9A×C®DšI‹M"JËQØO‡SAUB©>õ@‹BTC‡HaKcL39ô5ú6E50–-”(†#§ù7ð8F<í§r¥;€nš_Ÿß²%Ž?žž:°°hºŽŸ|œÀ=Ã×Ç È÷É6ž¶`ž!¶Ô°v®1š”¥s§M»7œ žˆŽI¿ó¿œ]¹pµT³{¯¶Öž”»¹í¶ÐŽË°ñ¬ç¹%žJºÆ²²®i©c¥B°Ÿ¬Â«Eª0§hŠL€ß¡©Ô¥5¢HŠÏ©«O€ç€º¢'ž­šŠI ûž[™ã•Ä¢— ê¥v©ç€œšÇ—’DŽ ™÷—”×÷˜è— ›Ø’³û‹Œˆ Žû“Šj“tŠPŽÏŽœŠÄ.ŠÀ‘ñ”“—»š^˜•"’ý”ÌçŽÄ—š% ¢Ú˜L“*“/•fí¡å§›©6¥ð©ó©²®>°B¯‰­öµýž:œ÷ÀbÀ3°œ°HªÍ©þ±â·•žuŽÊœ\§¡‡ #\óY˜£¢¡€)¢G¢w¢šF€Ô© ¬]©­©j±‰³Ôµ[§•€áŸÁžŽ£ÚŸwŸ_œ÷a #›#œ§—Ƙù–u”Ÿä‘‡œšž%ŸÑö¢·£ŸéЬ Q§£Û£G¥¢¡r¡æ©YªØ°±3³w™•j’ý–™ Æ–?•<‘¿”k‘ƏՌ¯†ÎŠƒ(„ԁU™£œÃ Â¢“Ÿ­œOš0›\—˜@–(¢.Š«š¯H€›ŸÁŸµ›ð¬4±°É¬õ±“¶ó°á޵Ž»ŽÒ¶$¹£º±¹g³í³šž”žN±ï¯á³XœÁžÃ.ÄÆ7ÊÆÏÙËÒøÐ%ÃyąÀ”ÁøÄOÆ.ȂÄUÆŸ»¢·Å¹·ù²I­Â¬®ª“š Ќ¥”¡v»OŒ•ÀÉÀŸ]Â/¿»¿áŒ¬¹;ŒïĔÉÈ«̞Î ΠÓEϳÄêÀ1»ÝÁgŒžÅR¿1ºÂ¶1ÂÙÇûÈÌGŒ+žp³¯6»ŒíÁßÇÃŽ]¯ü¬K­ã±ï°²ó·$°€§|£Âž¹žsšœ•¡’òŽ®’Q\Œõ‘ˆ~•“Ä‘~”˜c—=Œ„‰`‡/„׌bÒ‘•S–ò”Ëš ‡¿…·Æ}b‡zŒÛŠŽ>•~“<–Ù}\w«v@xtuo«l‰nJr“qhlhŽqçw€y€{y~zÇkÃg^a»^¢gjmoö`$Z¬Y¬ZVñWîW#Tc£€ €0€ €血0€!~„ óõœ1nÀYÐò¡àáôØ*Çì Mñ%¶ðŸœ ÀÆÚÝØ·æOùtën©}ҁñS²ÕâÌÆÉ²˜º+‚éö]DØ,SuoO(YE|ZõŽê°ØýÜ àáð–Ï֛ÕÀæ2Áç«h¡ê–ÔÆÆÉå¯äRɚ€£yšÛBÏ­y®°âJ*ñ}ó3Ù›‹»±ÉÂØ®šÎÒŸêVۈæ•ÎóÒ ÖÉ]Ÿ°¹‚•Í—,˜ÆŸÍž=€ªF€¹ª<·ÔâàÄ̳_šòãíï¥Â$é4ÿEõcý>ۈ6(ý¢ô¯S^ZO/\.öåúYËéü±D§€î~ôîevÔXµþ»9¢2ùº>o­eԓß _çrŽè/ãÏÁyžiõÇÉq-6¹FÉ®΀û?µ@ىÚ’¶Ï¿óªïÄ­šoãšõ”û÷è&“DŒ ˜Æ™ ¹æƵé¢ì|ÐÊɚÛöЄŸPäÔΙàÏv†-Þ%ØübҌԓÕâÚ¢ÇÎþ¯ÝËãþÿêαøäµåùtç·æ;ûšZ®„3y9 vó>hDöBa<­„fz3la;;à‡äo üÖ.Èäfæcÿ  B"æøŠ0Í$ÚyÎ6û üb÷ÖÝÂÍ ‰?ðû]ß>î3é¶ò0ÿc؇Çê°-™ç]¹c©Æ Î+ó˜á– .ñ™Î§§µ Û¥åÎÆ ŸÈú‹áŒž*®‘µ­¶²yœ+¥m³õŸöž¿sÛ|`{=N§Œ—…òvެ0«6”„Ÿ<ó»¢áÇý>Ö.ôU 3æúº†šòʉ·À­ŽŽ ‹d'ž’žœÖžñÕéÝÅ»ڎâ†Ø§§ŽŸœ¥œœŠ^_}œ«hwBÜPÏœÿÛ#ãDs *É.Æ×FãÆýÔæZðö{3%Ε!ö†Ö¯äûßÊñþÞÓžÂØó>Èœ·=Á¬Ä€ÒÓ{áù¹Z¹€ŠÍ1ٔÿE· ýòԓ©7œ7€Ø‘‹dågÉ«é$®s‘Ò±ŠÊvʼnÜŽ͂Úèÿæî¿‡Z°"šòš¯bDf%u%lQšŠ„M…f•’Ž÷n‹i³žŽSƒ`ß0‚Ÿ‚Z<uwL£Â8³¹Š­ŽÐƒ,° š¡wì– Š¯ðŽ9n•ˆIŸ.ƒê‡Œ=²ytqÔDŽ”už€LŸˆZÜMî„“Œå”Ó²¿k÷œîo5-WI¢|‡|jƒ ™ƒ={û»‰ Ÿ=~J€„²ëcôáʝú•X)g¿­eaÙgüK–Uѓ䘝‰‰Ãùƒ{¥ŸyÌ“²ŸœŠþÇŠÃ;ÖºŸ¥y ŸÞ}1~˧»Ú ¯m†$h¯[ƒ^\UnÈhöˆ,Ž‰&³~ŸëÒªòa̰æï€s²ÞºIÝ+©Šâ! ¶þ× @§&ŠÝ›Z¹Ž·Ý‹â€>}ÈŒO…* ªèßʈ!r-vo«…kvóû³>—„§|’Á•`™ƒpƋאˆ“ž¥'ÙN—{Š,ZŸ<vò}c‰€¬š—Ð ׌ž’`|ºuäÓœTИå’.%¿|:1('•„ÐpXnï `"fÏIÉdZ|‡ƒ!›©Ð\J¹Ø ð‡ ³~nŽÒøñý3þ}úE΀ —à€Ćžê}ù¯"ÈÆf•‡{p‡;—àdPZ–f%VÁNeb¬T›Œ\€WÙŒ ±*fÙ“Š‚P~JT×]„nïk0„íŽC‰€{¶§ÇiÂÄã/ §üšîÙ÷»Úž\œT]£Šžxæ”[›•²ò²eäG„žâRƆ~±s‹ª1€LÒ2–%†`p/Í}щ&šRow’t®’\ÆV7ù^tvòX˜…R•Ä{î” ™Ô®‹Š€‡dwZoØ©UÆR”¡”µzW›‹‘{Ôrö‰”˜Cÿ†‡vynsŽe^—®kŒ©…o™Ž°?€~£¬‘š¬Á„¶a™[oÕ„ŠԞw¯Šrœ_Ñ¥|j_(m.sÇP7‚I)No;’F'_2q—v„iÜiYpãuNƒ^xFŸ‰l€«b—w.~®€¶z퇎ÃFW¬Ð’rŠ—w¥pÆ[|jÁŠcLY8a²v¿ož{À]—qq—klŠƒg[X^U—Õ{”RŠÉ‹«Iº@¬˜u¥ —!‹|õ‚'î>ãžá ٝ}©nŸ„D¥xc{Êx 1VD\Kbpƒr€L‡Ç‹U–æށ­Qnx·Ž å©„u¯w©t™)Û×µ|Ȃn(¥ —³ìá2”[â,›©÷”µ-Ì)vŠ(^æ'-S;;>\'1Qu;nYçMpOnVøhðŽœAÂ8WC(Iö†üMÐe›˜/©ŠŠg_> LFq©7·ÝÍ< ¬WœÈ揫— ‰:“vW•Ø{„¶žŽÙ§/•‘³¯P󬁑eþpíjI†~`5v ÆGŸK²eµà¥ï·¬ºq‹ºÉ»kÑL¹Z¶«àºÖì«à²òÕ)á2JÈ…š§ãû"ÞDßãÚ®s× ¢©0€ €¡€0€€€helix¢€ €¡€0€ €¡€¡€0€0€ €¡€ ¢€¡€¢€0€ €0€ €B@¡€‰A¢€:H0£€‰X¡€0€ €B@¡€ì1°¢€H€Ð£€ŠbP¢€0€ €¡€0€ €¡€0€€€helix¢€ €¡€0€ €¡€¡€0€0€ €¡€)¢€3¡€¢€0€ €0€ €B@¡€l'€¢€Ö@£€ѐø¡€0€ €B@¡€쇠¢€`$p£€Ëÿ0¢€0€ €¡€0€ €¡€0€€€helix¢€ €¡€0€ €¡€¡€0€0€ €¡€8¢€J¡€¢€0€ €0€ €B@¡€âaø¢€’fÈ£€¢]@¡€0€ €B@¡€?Ä8¢€žÃð£€RÈ¢€0€ €¡€0€ €¡€0€€€helix¢€ €¡€0€ €¡€¡€0€0€ €¡€O¢€V¡€¢€0€ €0€ €B@¡€‡M¢€Æ `£€=P¡€0€ €B@¡€¡Qž¢€êµ£€³`ž¢€0€ €¡€0€ €¡€0€€€helix¢€ €¡€0€ €¡€¡€0€0€ €¡€[¢€e¡€¢€0€ €0€ €B@¡€•/h¢€Öࣀ=ò8¡€0€ €B@¡€ÜvX¢€mÀ£€…8P¢€0€ €¡€0€ €¡€0€€€helix¢€ €¡€0€ €¡€¡€0€0€ €¡€i¢€p¡€¢€0€ €0€ €B@¡€P'ˆ¢€‚»£€ÞI¡€0€ €B@¡€@l0¢€ÜYP£€ŸpÀ¢€0€ €¡€¡€1€0€ €0€ €÷ÿ¡€0€ €M781£€0€¢€0€ €Protein Data Bank¡€ €¡€0€ €Ρ€ ¢€¢€¡€0€ €PDB¡€¡€M781£€¡€0€ €Ρ€ ¢€€€¡€0€ €0€ €¢€0€¡€0€ €¡€0€ €¢€0€ €0€ €¡€Casp3 Model Structure¢€NA§€ÿ¡€0€0€ €¡€0€ € £€SEQRESš€¢€ €¡€M781 0£€0€0€ €¡€ 1 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€'0€ €¡€ 2 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€10€ €¡€ 3 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€%0€ €¡€ 4 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €¡€ 5 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 6 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 7 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 8 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€10€ € ¡€ 9 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€ 0€ € ¡€ 10 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ € ¡€ 11 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ € ¡€ 12 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€10€ € ¡€ 13 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 14 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 15 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €¡€ 16 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 17 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 18 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€ 0€ €¡€ 19 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€40€ €¡€ 20 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 21 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 22 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€ 0€ €¡€ 23 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 24 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 25 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 26 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €¡€ 27 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€+0€ €¡€ 28 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 29 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €¡€ 30 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 31 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ € ¡€ 32 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €!¡€ 33 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€:0€ €"¡€ 34 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €#¡€ 35 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €$¡€ 36 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €%¡€ 37 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €&¡€ 38 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €'¡€ 39 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€70€ €(¡€ 40 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €)¡€ 41 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €*¡€ 42 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€40€ €+¡€ 43 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €,¡€ 44 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €-¡€ 45 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €.¡€ 46 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €/¡€ 47 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€%0€ €0¡€ 48 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€(0€ €1¡€ 49 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €2¡€ 50 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €3¡€ 51 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €4¡€ 52 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€10€ €5¡€ 53 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €6¡€ 54 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €7¡€ 55 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €8¡€ 56 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €9¡€ 57 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €:¡€ 58 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €;¡€ 59 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€70€ €<¡€ 60 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €=¡€ 61 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €>¡€ 62 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €?¡€ 63 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €@¡€ 64 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €A¡€ 65 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€%0€ €B¡€ 66 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€10€ €C¡€ 67 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €D¡€ 68 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €E¡€ 69 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €F¡€ 70 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €G¡€ 71 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €H¡€ 72 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €I¡€ 73 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €J¡€ 74 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €K¡€ 75 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €L¡€ 76 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €M¡€ 77 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €N¡€ 78 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€+0€ €O¡€ 79 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €P¡€ 80 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €Q¡€ 81 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€70€ €R¡€ 82 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €S¡€ 83 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €T¡€ 84 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €U¡€ 85 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €V¡€ 86 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€70€ €W¡€ 87 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €X¡€ 88 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€(0€ €Y¡€ 89 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €Z¡€ 90 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €[¡€ 91 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €\¡€ 92 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €]¡€ 93 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€10€ €^¡€ 94 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €_¡€ 95 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€10€ €`¡€ 96 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €a¡€ 97 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€10€ €b¡€ 98 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€(0€ €c¡€ 99 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €d¡€ 100 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €e¡€ 101 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€70€ €f¡€ 102 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€(0€ €g¡€ 103 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€ 0€ €h¡€ 104 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€:0€ €i¡€ 105 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€+0€ €j¡€ 106 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€+0€ €k¡€ 107 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €l¡€ 108 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €m¡€ 109 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€70€ €n¡€ 110 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €o¡€ 111 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€%0€ €p¡€ 112 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€10€ €q¡€ 113 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €r¡€ 114 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€%0€ €s¡€ 115 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €t¡€ 116 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €u¡€ 117 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €v¡€ 118 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €w¡€ 119 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €x¡€ 120 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€(0€ €y¡€ 121 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €z¡€ 122 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €{¡€ 123 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€+0€ €|¡€ 124 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €}¡€ 125 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €~¡€ 126 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 127 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€70€ €€¡€ 128 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 129 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€/€€0€0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€ ¢€ 0€ €0€ €¡€ ¢€¡€0€ €¡€ ¢€0€ €0€ €¡€ ¢€¡€0€ €¡€ ¢€ 0€ €0€ €¡€ ¢€¡€0€ €¡€ ¢€ 0€ €0€ €¡€ ¢€¡€0€ €¡€ ¢€ 0€ €0€ €¡€ ¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€ ¢€ 0€ €0€ €¡€ ¢€¡€0€ €¡€!¢€ 0€ €0€ €¡€!¢€¡€0€ €¡€"¢€0€ €0€ €¡€"¢€¡€0€ €¡€#¢€ 0€ €0€ €¡€#¢€¡€0€ €¡€$¢€ 0€ €0€ €¡€$¢€¡€0€ €¡€%¢€0€ €0€ €¡€%¢€¡€0€ €¡€&¢€0€ €0€ €¡€&¢€¡€0€ €¡€'¢€0€ €0€ €¡€'¢€¡€0€ €¡€(¢€0€ €0€ €¡€(¢€¡€0€ €¡€)¢€ 0€ €0€ €¡€)¢€¡€0€ €¡€*¢€0€ €0€ €¡€*¢€¡€0€ €¡€+¢€ 0€ €0€ €¡€+¢€¡€0€ €¡€,¢€ 0€ €0€ €¡€,¢€¡€0€ €¡€-¢€0€ €0€ €¡€-¢€¡€0€ €¡€.¢€ 0€ €0€ €¡€.¢€¡€0€ €¡€/¢€0€ €0€ €¡€/¢€¡€0€ €¡€0¢€0€ €0€ €¡€0¢€¡€0€ €¡€1¢€ 0€ €0€ €¡€1¢€¡€0€ €¡€2¢€ 0€ €0€ €¡€2¢€¡€0€ €¡€3¢€ 0€ €0€ €¡€3¢€¡€0€ €¡€4¢€ 0€ €0€ €¡€4¢€¡€0€ €¡€5¢€0€ €0€ €¡€5¢€¡€0€ €¡€6¢€ 0€ €0€ €¡€6¢€¡€0€ €¡€7¢€0€ €0€ €¡€7¢€¡€0€ €¡€8¢€ 0€ €0€ €¡€8¢€¡€0€ €¡€9¢€0€ €0€ €¡€9¢€¡€0€ €¡€:¢€0€ €0€ €¡€:¢€¡€0€ €¡€;¢€0€ €0€ €¡€;¢€¡€0€ €¡€<¢€ 0€ €0€ €¡€<¢€¡€0€ €¡€=¢€ 0€ €0€ €¡€=¢€¡€0€ €¡€>¢€0€ €0€ €¡€>¢€¡€0€ €¡€?¢€ 0€ €0€ €¡€?¢€¡€0€ €¡€@¢€ 0€ €0€ €¡€@¢€¡€0€ €¡€A¢€0€ €0€ €¡€A¢€¡€0€ €¡€B¢€ 0€ €0€ €¡€B¢€¡€0€ €¡€C¢€ 0€ €0€ €¡€C¢€¡€0€ €¡€D¢€ 0€ €0€ €¡€D¢€¡€0€ €¡€E¢€0€ €0€ €¡€E¢€¡€0€ €¡€F¢€0€ €0€ €¡€F¢€¡€0€ €¡€G¢€ 0€ €0€ €¡€G¢€¡€0€ €¡€H¢€ 0€ €0€ €¡€H¢€¡€0€ €¡€I¢€ 0€ €0€ €¡€I¢€¡€0€ €¡€J¢€ 0€ €0€ €¡€J¢€¡€0€ €¡€K¢€0€ €0€ €¡€K¢€¡€0€ €¡€L¢€0€ €0€ €¡€L¢€¡€0€ €¡€M¢€ 0€ €0€ €¡€M¢€¡€0€ €¡€N¢€0€ €0€ €¡€N¢€¡€0€ €¡€O¢€ 0€ €0€ €¡€O¢€¡€0€ €¡€P¢€ 0€ €0€ €¡€P¢€¡€0€ €¡€Q¢€0€ €0€ €¡€Q¢€¡€0€ €¡€R¢€ 0€ €0€ €¡€R¢€¡€0€ €¡€S¢€0€ €0€ €¡€S¢€¡€0€ €¡€T¢€ 0€ €0€ €¡€T¢€¡€0€ €¡€U¢€ 0€ €0€ €¡€U¢€¡€0€ €¡€V¢€0€ €0€ €¡€V¢€¡€0€ €¡€W¢€0€ €0€ €¡€W¢€¡€0€ €¡€X¢€0€ €0€ €¡€X¢€¡€0€ €¡€Y¢€ 0€ €0€ €¡€Y¢€¡€0€ €¡€Z¢€0€ €0€ €¡€Z¢€¡€0€ €¡€[¢€0€ €0€ €¡€[¢€¡€0€ €¡€\¢€0€ €0€ €¡€\¢€¡€0€ €¡€]¢€ 0€ €0€ €¡€]¢€¡€0€ €¡€^¢€ 0€ €0€ €¡€^¢€¡€0€ €¡€_¢€ 0€ €0€ €¡€_¢€¡€0€ €¡€`¢€ 0€ €0€ €¡€`¢€¡€0€ €¡€a¢€ 0€ €0€ €¡€a¢€¡€0€ €¡€b¢€0€ €0€ €¡€b¢€¡€0€ €¡€c¢€ 0€ €0€ €¡€c¢€¡€0€ €¡€d¢€0€ €0€ €¡€d¢€¡€0€ €¡€e¢€0€ €0€ €¡€e¢€¡€0€ €¡€f¢€0€ €0€ €¡€f¢€¡€0€ €¡€g¢€ 0€ €0€ €¡€g¢€¡€0€ €¡€h¢€ 0€ €0€ €¡€h¢€¡€0€ €¡€i¢€0€ €0€ €¡€i¢€¡€0€ €¡€j¢€0€ €0€ €¡€j¢€¡€0€ €¡€k¢€ 0€ €0€ €¡€k¢€¡€0€ €¡€l¢€ 0€ €0€ €¡€l¢€¡€0€ €¡€m¢€0€ €0€ €¡€m¢€¡€0€ €¡€n¢€ 0€ €0€ €¡€n¢€¡€0€ €¡€o¢€0€ €0€ €¡€o¢€¡€0€ €¡€p¢€ 0€ €0€ €¡€p¢€¡€0€ €¡€q¢€0€ €0€ €¡€q¢€¡€0€ €¡€r¢€0€ €0€ €¡€r¢€¡€0€ €¡€s¢€0€ €0€ €¡€s¢€¡€0€ €¡€t¢€0€ €0€ €¡€t¢€¡€0€ €¡€u¢€ 0€ €0€ €¡€u¢€¡€0€ €¡€v¢€0€ €0€ €¡€v¢€¡€0€ €¡€w¢€ 0€ €0€ €¡€w¢€¡€0€ €¡€x¢€0€ €0€ €¡€x¢€¡€0€ €¡€y¢€ 0€ €0€ €¡€y¢€¡€0€ €¡€z¢€ 0€ €0€ €¡€z¢€¡€0€ €¡€{¢€0€ €0€ €¡€{¢€¡€0€ €¡€|¢€ 0€ €0€ €¡€|¢€¡€0€ €¡€}¢€0€ €0€ €¡€}¢€¡€0€ €¡€~¢€ 0€ €0€ €¡€~¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€€¢€0€ €0€ €¡€€¢€¡€0€ €¡€¢€£€0€0€ €¡€0€ €!NCBI assigned secondary structure¢€0€0€ €¡€helix 1¢€€€ €¡€¡€0€0€ €¡€¢€0€ €¡€helix 2¢€€€ €¡€¡€0€0€ €¡€¢€&0€ €¡€helix 3¢€€€ €¡€¡€0€0€ €¡€)¢€30€ €¡€helix 4¢€€€ €¡€¡€0€0€ €¡€B¢€K0€ €¡€helix 5¢€€€ €¡€¡€0€0€ €¡€P¢€W0€ €¡€helix 6¢€€€ €¡€¡€0€0€ €¡€[¢€i€€0€0€ €¡€¢€0€ €QSingle-coordinate-per-atom model from PDB entry M781 with a vector model attached¢€X-Ray Diffraction£€ NA NA £€0€ € €€0€0€ €¢€ € €0€ €<¡€0€ €<¡€0€¢€0€                                             !!!!!!!""""""#########$$$$$$$$$$$%%%%%%&&&&''''''''''''(((((()))))))))**************++++++++++,,,,,,,,---------...........////////00000000000111111111222222222333333333444444455556666666666777777888888889999:::::::::;;;;;;;;;;;;<<<<<<<<===========>>>>>>???????????@@@@@@@@@AAAAAAAABBBBBBBCCCCCCCCCDDDDDDDDEEEEEFFFFFFFFFGGGGGGGGGHHHHHHHHIIIIIIIIIJJJJJJJJJKKKKKKLLLLLLLLMMMMMMMMMNNNNNNNOOOOOOOOPPPPPPPPQQQQQQQQQQQQRRRRRRRRSSSSSTTTTTTTTTUUUUUUUUUUUVVVVVVVVVVVVWWWWXXXXXXXXXXXYYYYYYYYYZZZZZZ[[[[[[[[[\\\\\\\\\]]]]]]]^^^^^^^^_______```````````aaaaaaabbbbbbbbbbbcccccccccddddddddeeeeeeeeeeeefffffffffffgggggggghhhhhhhiiiiiiijjjjjjjkkkkkkkkkklllllllllmmmmmmmmmmmmnnnnnnnnnnnoooooooopppppppqqqqqqqqrrrrrrrrsssssssssttttuuuuuuuuuvvvvvvwwwwwwwwwwwxxxxxxxxxxxyyyyyyyyzzzzzzzzzz{{{{{{{||||||||}}}}}}}}~~~~~~~~~~€€€€€€€€£€0€                                                                                                                                                                                                                                                                                    ¢€0€ €血0€Åµ‘ýHùüõeðåä ˜I°qÞ|ý—ûž ~ ûxõßó#ïÎô×öNôò?óÈð†ôñÒóÂñÐóLñRöÂøÃúœûFþÅ„” æ ”‡÷Ç÷Úý ÿhó‚îêPíËþϺÿã 5A• …&~ò-ú Ï ¡ìÉc“ ƒ 7òG €ÚÓ» t§ ö[w%£º ÃŒ M Œp—õ {Që±þ¶ÿ&Ÿ)ÌùS>ò­ ` eæÄ൮ô4Õý¿üxE xûAöYöÒóÕôÃï¶ïêéáçè›á ãBßÓú–ûtý!û~ÁÆfMýàþVÅl Ü  #ù—õñÿð×ñhóŸð»ø•ð­í»ñï ëÝçŸã6èóö*ùÉø«ùºÿkŽ— ö‡õCðÍïó›÷ßöñ]ù7îæê ì|éUæCäñŸóèó#ó¬ðüîñíñàñö.ú^îQèµæ¥åõ×úzú–öÀú–ö7ÿ¡û¿ùÈ$ ˆÑÐúª÷ñÂï"öúÛùÝõwýzð=ëJë9ç@ê`èÿã°âEÝ ï£ðîÛìõ§ö@öÍðéðê<èòìøgçÃâ8ÞìÛ/àmâ•àïÞ0âbàQÝ|Þ.ÚÕßxÞ Ø<ÖÏÑòÑÎâ‹ã¯á/àŸé•ë¹ß²ÝAáJàæêUíìŽîrìdêíëíé êèœæŒï§òföõùgôŽømøüY›íüvøøjóÿô4Y5/ Ÿ’¥ Y« žÀPàj( šÿ ÿ>èýèþÄÁ  Ü V•h£ ŠùàáŸÓP €rî7»Áé³õÂiƒp. Ð þ ™ÜõيȝÛIÁ$Q'?+h%2*×+i11®%'t&ž*ƒ%'’%'Š%!Ñ ”#$Ô«Ár<ü#)%l+/.C"€Z%h,Ÿ2377š/;/Ù*ø&¶0Ù5Ã5Ì;I:¿>+ž'D#n$ø)?% m[Ý*8} ­Æì‡#×$'Q+£)§, /235_538G%G"ö ¥!œ— „ ”"D"T$$ %Ìnóá¥é³ö#·'ò).)Þ,ê,±1Â1†5<4®9})w*ž&õ(±)ü-³!ãù÷úÐ ˆŒ§ w ë" &f&˜#Çm!j)ã.?,Z.Û164{9Š=Û'ê%­%ò'˜æjÈ$P$])á*œ"H!±“ò-š3 5C8+6~5<;7¡3à5º3Ð6Ô3Á.È,t.ò0&˜#fš“/Ä2 7¬9O2Z-*ê%°#w:?ì@2CBKHKgIÙ<¥—1Î0<+(²)a;t?oDçHœ?9ëE<J=MÑR1MIúIHfKïNöKoF»QýNŒQ¯VŽOFMºJÌI­MN^QüSVDôCbCC•=Æ9ä=L4;C³Cà>Ÿ>¡DãJfJœN`:5V4ÿ31!+§(ò)6#ð$5!”˜6î6Ù9Œ7ˆ9©6¶:1É>A>;>ŽFa;k8{4{4352Ò00<-˜1b-d/Å-Í*—&#_?p746ª887J; :š:Ÿ9Ÿ9°8®8¹7Ì:™^a‚ch_]^2hgm&qõqÃvN]>YST’RœWi[žSJR•N N¹KAM,H$C`GñS8T`TQ­YãZA[VVªQ,OŽZ _Ýbùh’lqjžN(HÒE^AÛFXIV@ÅF`C[D@NEC-Ff>-DšGNEPPQÖW²Ym_*GD_>|;ÌEyJúLDN?<€6ì5415š5Ñ5¹65ë6N656f8z7M74";z:46œ<›5p;p7ß:V:563+>bD G…Dü2ø-Ü)ë&t+¬&.ë*w&ó)%&Ú&Œ+Ï-I-œ0 ,;+é4U5Æ0¿)I%h!G¶"¥%éÉÐQ ŠÓ.™}ªU$&Ï#ð$Ç,V,‚,·,v,ß,ž,Ó,û ŽŽœ$P¡ŽOÙ“ª—ò k s Ö €· Y.–&F  Õ V Ÿ? 0> j 5Ëÿ$ÑR!mVA6ý"áÿ7þýàýbÇG%YÅ ¿iã@pýÿRø>‘âyŸ j$$&Î&š(`&X*Á(Ö+Î)¹0Ù)J+ÿ0r/ø(9#Äï$gÕ Mˆ4Æ9R8!:q=æ@‰DºC4‚3/ù,º/‹2]2)5º5761 .m(„&W0!5?4ª%ñ FœÔF3$±‹škfñåcÁ s#$$– Þ B*,O.,Ð0(/dºíœç€ù> ;¬ ºrêU ™ E· 'E"”AP¢€0€üýû‡ù“ö®÷-ø×ýïúoû,ù–üDúIúü†øFÇœ'R G „£ññü‡ýx;¿÷Žó"òÌñ°î íXèIç–ãÁãnàAóÂóùûüðõë8èßãkàšÛªâžúYÿvrüÜÚ=‚ÿ$SÊ× ` Å ð (œT á :_ûÈ÷éü <€ì ×°Èx`3á䩇‰ö4Å~» 2¥ u$Ÿ) ¡$Ò#u'3)z-Ö$(E+0)å.!-`&€(9,Ÿ0D#Á—,0Ž69à/®*Ù4T)68;=AŸ:>? Bë=³9ˆ:ð=`Ay6406 :Ó<ŒBkEÃ9~;2=ï:E>Æ<7ŒúKGP<OÆTÄTU@<6þ3˜;6Y?í6‰1ë11,ý2g2y5O5"3ö0ò:`;@äC³BC6_5—0 .9[??÷EnG=LDD-œ(J$N¹'S'ä&"ª1â!*!c&/¡)Äû‡®‚¹!V$#-T((â,R)•)ö135 9É=›B5&Ô$ç!C$æ&î&ï**,&V,Í(ó,$MBŒl™I NÊ R ýã"z#º"ø'š*|'6/€%©'"8"f)p.Ý1.r5ÍîL*ž †ŒDýéYntÀ õ wk"§"ã"²'é,-£/±1Ý3ë5#O#’÷Ÿ#{$U$L%%L’4å· œøÜýG:ä_­!M b S—ú"•#&%)'ž'•,f!]!«'(*P/‹1>/33‚2ƒ/ú3Ÿ/«1Ù4ü6÷:=t:<¥8·;S@óBÉ;g6"6ž3ëC­II—MaEœE»E«Gù@é@ù<8w;ÏCB¥GÚIÂ>‘8þ6T6i1;1Q.Œ)šJ#O#STW&QM„V™N”RšVRVë[DTTîSSDQmQ¿OER†RŒV5Y|MI‘UŸXà^ŠaõW‹ZBXÙ[5_ça»bÃ_×e9gƒl;e€dodÅc©cÖd$eÒi lÛa^?bNbëg€j@p%shÊc<kXqówƒy»}æxw~3~ý{ ƒŽvìxšxŽ|BtêuVvOq5tÆtgy{jofz1~€ƒ²†ï~ÞzpzË~Vw„x‰F‰ïŽB‰9‰ðb"•k…Ÿ…ž‡³Šà€<Ò‚Çz%…͇aMÊ…†w„…mƒŠ•.˜š§–ÊœjÛšr¢d—®šE˜ì›W˜—™• “\‘E•—îš —Hžû‘f„Œ‚”˜^œÐœ‹ ’‹Œ‰d`Žz…ƒù‰7ˆ“f‘!Œ`•XÔ—«’Š”’èe—–™äžŸ•ò‘ûãІù’ÐŒ$…V‹­‹Pˆ³ƒHµ{‚œ„º„T‡Y~K}âyé€Ô‚‚!}»zÖ‡P‡ý0EŽ-}By5sÊpŽyku›v reqánatßrÐmÈljhmâmÁrSir>hèmmvp'oZk@h k[g¥j0núe“bk`”aK]­^d\–fõhäh h ffàcÏ`õdAgNfrieg„`¢_Œnq>nov~z,û‚˜kÇie%dþfirfUaŒi b^`ª^ò[XfWdÃgŽhúhlœo›l^t¯k;lÉh!hio'sµp°cÙ_\î[@Zè\WšXÅUÙW*Qž\óZö^K\LZòW§Xçcbgeâe1l£nÉnÐpÈpËrÃrÆe¹d¯_ê_êcªcb-a‚`¬[ÚW WÞUxRŸP™L£S8[E\j_t^ƒ_°\«W>_ATt\‡WTPcfNbÿdj„nerVnuçq«uŽ^í[rYY›VøX¶UL]V|T WÒVAR3PXM¶\Ð`Õcbg d¿d£^øaoc…dh<_{])\Ž_÷`d2eÿZ»Y–ZÚW-YYW#e¶i®m®ozg,d'aª^¶\8orÜx{JsÒv¿|+t~àvº|+~Úxâ}µ|±xS€:|Îrƒõ‡S‹P†³€Á€O}{…¹ˆ©…X†-}í{nusç}Ö}@ƒŸr•lòk mžjkFjm¹ffd aö`A_§aa[ý_Db `Z%W¿b0hj fýo'WÊROäR“JøH_F™CóCDÇ?æ;@kHF¡KlOÑCíGJJŒNËP3M9M;L/J³IrG’FŒF¹TÀVZC]vYwV+VcRØSZOÏP YÍ]bÍf[[`V9TÇVšc€hékŠiChŸgbi•a±f8p­sÀs)rŸy]xÐt<sr’vrus‘o3mq<{<P~(~Ó„š‰Š+‹Š|m{,w+vßxèx†|µth{,v2tprˆpIlÄhc h*_Vcê_z[6w$yåp‚îz;tñr‚s%€8…W‰_ï…‰ü£€0€ùíý¥¿ªûföÀø\üi͏ WµXÁÁ œ”ðLS  €hœšÐ šW³ æv¶üŠ÷Äþ'qÇœìf­þfÚZ!­$/&ê)(E%Ö({ Ç&Ì)D/0˜&Î!V)_2P7÷9ß7v:¶9ç<Ö6V>5@rFKHÍ?œHsNQ>OsOALlUL¯VYƒ[…\…^La6\—\^YâZü_jd&`ºiU"PÖPN KÀGHF”BØBC@Q}PèT“S:R&NŽY9]Zÿ[”bdðeÊidXV_QþQ°T"R/VšOÉN›J=L$J:GCÙ@‰D¯OéRSÉRVØYB]ËWD^ÀZÌRØZ RU¯W2Y$TÃT’]Y`'Zãe Q@LÜJJIWH¹DK@LA†y»q°qtbrÏr•nËqi˜y|žz{#e„Û‰g‰ÊŒ•vƒs»pJoæp<s4uÒxµ{cmÌjbmPkPh&e?d]ruEvru™zyy³xjy¶tæu'{ô\ƒX€s‡Ìp…k€ižfÔgrhjgŸh|hKi"gCki[mk£iRneq§u‚x,yêxxzì%&vÞr–mÈs^iØozj°fÇ‚Œ†ü„ð ŠÜˆ‡—† †ƒ‰~ˆf‹ôŠäŽqŠã‹Û‡«…ÿ‘(•µ˜¯—Μ‚œ –‚Ÿ™sŠ†‚|Ëz3/}<~jw»zv{Hv`vruÙp€l/pÄzczžyÜw逿† ‰R‡#|b{ývTtw:‚v‚Œ„è„LJdsn(j«g?l@n¢mf;kŽh}i-e^j0gPbCi©_žgbn o?làju(vÉ|²~R„mzkee€bmàlBnðmCoåcÌ^?[7VÍ]g_F\pW_]œ[#\Yh\å[Z³a)bóeJfÅeœgÆjºiÓcj`g[§a,Yë]5nCq[mújþušx¢ntkqj8eÔn~o8r§iûn mxiffriDeŽ_ñ\vf\khl0h÷pz_YæX3SìY×Z%^ßUŽ_/UñZœ[ [“ZnY?VŒ__á^dä[KZuT«R»];c%e£kVnxsœlsQìLXIhFYJL4JZGÌHÕE|IÐFâI&F4G1DOKM~NúK J»T±X˜^.bg‘IÈF…Aå@[DcHsK1E¹?®;:;ú8y:i9í5{@AÇAz?<GLH¶N0PÞOËCÀC¿>9<ÍGLÏF]P0;!5Á2€/¢3:2ó0 1‹..1-.Ù0A3.N6œ86‚50>‡A*@5BìAî6A4].Â-o4‚3#73!+{&%|$'#T `ì&‰&.(ø&~(®'™*,©)~.%1H/]0ö78ù+ï)Ê.,ÿ'"€¬"×2å7V;z:©9Ý;÷>M>)@F?íD5H|KÂF.A»?vHmLMQÍRKSKÏEáKÂU±[#\Ë`J^·^’aû`ŒZC[wZ ]2XWYM]ÌUµ^ŽV[[þU„SÂW­YNƒIµDÙHÍY]Fbwe'^GcÝhŸhòlÆiPn‰núk3sdÎdeh_:^ŒYxXàTTaPsbHbhiæ_,Y[VnVÏQQN§I\jÈp)pytl°l‡nFnjfúdùh[_Žfƒ]Üa=o›qXm/nXvPzôº^ƒÒhWcÿ_#\-b¢^u^XY×TÀPÑZ^^^©[Žb?TÙP>N=I“Q†RtSóT`TÂQÉPbMÞIÄU5W’S§PZN\H EmQnP=Q¯SQGXAý>K:'A…DÀ;å?Ð<£;ô7²?5?A–A€DCêF­@.@<Š9îEŠHðEL<~9K30Ÿ:S?rCÉ?ìHD¢Hé1Í,W*U%õ+°& %¬ œ-,+Û(¬0/°2, /=/h*–(s4;9M9P>=îBžBžG8(æ$TcÊ#–_ =‰\š<»•Bº{tPy㉗"/!–$TÚß÷Û_ à!P+ — 4ZS ÖÊ%z  !  ± · (á…ÝÊ3+Žò7KÄ(  ïNEšžü÷qÑ ²&þñþú/ùºöŒ°  ŠãX†ÈÁûÜüû|þýÁø#ôÑ Ô E ÷ñâð±ô6ñdñ ñòë¶ê éÊèòäŸäfÞìÛ7Þgê…ê`ïÓóŒðõõtù0õšõŠõöö ö"ñ›ñŠòñìeèóºôoïMëˆøZýÔ…¿ ’3 Áï.êëäïsæåäúçdàÃå¡ßájééþèŸëæèäíjåãŽçáê‚Þ¯ÙÙ×ùÖӚÒiè›ììAçýëzèœåðÃð÷íQê©ö‚ú{ùòí6éãä"àÝë)è/èØääâìݏÛ4ÖrÝ[×óÕkÔКÏÐޑÜÓÚLÖ»árßäÝáàqÜrßÝۙÜ+ÚØrØsÞ6߂Ü=äK× ÕeՇÔ@ÏÐÎ>0€ €¡€0€€€helix¢€ €¡€0€ €¡€¡€0€0€ €¡€¢€¡€¢€0€ €0€ €B@¡€×i`¢€?â £€1ô8¡€0€ €B@¡€#f€¢€¬ ø£€K5¢€0€ €¡€0€ €¡€0€€€helix¢€ €¡€0€ €¡€¡€0€0€ €¡€¢€&¡€¢€0€ €0€ €B@¡€ÿpX¢€”ø£€¯Œ¡€0€ €B@¡€ížP¢€#ž£€Ά@¢€0€ €¡€0€ €¡€0€€€helix¢€ €¡€0€ €¡€¡€0€0€ €¡€)¢€3¡€¢€0€ €0€ €B@¡€—È¢€f©@£€…ð¡€0€ €B@¡€õ梀ŠÃp£€`¢€0€ €¡€0€ €¡€0€€€helix¢€ €¡€0€ €¡€¡€0€0€ €¡€B¢€K¡€¢€0€ €0€ €B@¡€õ՘¢€EkÀ£€žGˆ¡€0€ €B@¡€šcp¢€¬X@£€P袀0€ €¡€0€ €¡€0€€€helix¢€ €¡€0€ €¡€¡€0€0€ €¡€P¢€W¡€¢€0€ €0€ €B@¡€Ì`P¢€²‚`£€šdˆ¡€0€ €B@¡€ó-袀3v£€L6ࢀ0€ €¡€0€ €¡€0€€€helix¢€ €¡€0€ €¡€¡€0€0€ €¡€[¢€i¡€¢€0€ €0€ €B@¡€²!¢€c1°£€V X¡€0€ €B@¡€we¢€™Aˆ£€XoÈ¢€0€ €¡€¢€0€ €0€ €†Ÿ¡€0€ €99999¢€0€0€ €;š£T¡€0€ €T079 0¢€0€0€ €þÇXŒ¡€ T079 0 M781 0¢€È€€¢€0€ €¡€0€ €†Ÿ €÷ÿ¢€0€¡€¡€0€0€ €¡€ ¢€|¡€¡€0€0€ €¡€ ¢€|€€0€0€ €¡€0€¡€0€ €'¡€þǪ¢€üµ £€ý;  €0€ €'¡€Ž¢€æû£€È€€èG¥€Š€㧀ꯚ€â'©€ò¡€0€ €'¡€ü’¢€H£€Ùý¥€0€0€¡€'€€t¥€c²£€1€ €0€ €1€ €¡€T079 0¡€1€Ž€0€ €¡€0€ €Ρ€¢€¡€&Transcriptional Activator; A Bipartite¢€0€£€0€NAŠ€Revision History:~ NA NA «€0€ €1€¡€0€ €0€ €¢€0€S.Rhee R.G.Martin J.L.Rosner D.R.Davies¡€0€ €¡€0€ €Ρ€¢€§€¡€0€ €¡€0€9101112131415161718192021222324252627282930313233343536373839404142434445464748495051525354555657585960616263646566676869707172737475767778798081828384858687888990919293949596979899100101102103104105106107108109110111112113114115116117118119120121122123124¢€0€ € ¡€ ¢€Š€¡€AMTMSRRNTDAITIHSILDWIEDNLESPLSLEKVSERSGYSKWHLQRMFKKETGHSLGQYIRSRKMTEIAQKLKESNEPILYLAERYGFESQQTLTRTFKNYFDVPPHKYRMTNMQGESRFLHPLNHYNS£€1€0€€€ €1€0€¡€°€ €€helix 1Š€£€0€ € ¡€£€ €¡€T079 00€¡€°€ €€helix 2Š€£€0€ €(¡€2£€ €¡€T079 00€¡€°€ €€helix 3Š€£€0€ €7¡€I£€ €¡€T079 00€¡€°€ €€helix 4Š€£€0€ €N¡€U£€ €¡€T079 00€¡€°€ €€helix 5Š€£€0€ €Z¡€d£€ €¡€T079 00€¡€°€ €€helix 6Š€£€0€ €h¡€o£€ €¡€T079 00€¡€š€Domain 1€€ NCBI DomainsŠ€£€0€ €5¡€€£€ €¡€T079 0 €0€ €1€ €¡€M781 0¡€1€Ž€0€ €¡€0€ €Ρ€ ¢€¡€Casp3 Model Structure¢€0€£€0€NA€€X-Ray DiffractionŠ€Revision History:~ NA NA «€0€ €1€¡€0€ €0€ €¢€0€¡€0€ €¡€0€ €§€¡€0€ €¡€0€123456789101112131415161718192021222324252627282930313233343536373839404142434445464748495051525354555657585960616263646566676869707172737475767778798081828384858687888990919293949596979899100101102103104105106107108109110111112113114115116117118119120121122123124125126127128129¢€0€ € ¡€ ¢€Š€¡€AMTMSRRNTDAITIHSILDWIEDNLESPLSLEKVSERSGYSKWHLQRMFKKETGHSLGQYIRSRKMTEIAQKLKESNEPILYLAERYGFESQQTLTRTFKNYFDVPPHKYRMTNMQGESRFLHPLNHYNS£€1€0€€€ €1€0€¡€°€ €€helix 1Š€£€0€ €¡€£€ €¡€M781 00€¡€°€ €€helix 2Š€£€0€ €¡€%£€ €¡€M781 00€¡€°€ €€helix 3Š€£€0€ €(¡€2£€ €¡€M781 00€¡€°€ €€helix 4Š€£€0€ €A¡€J£€ €¡€M781 00€¡€°€ €€helix 5Š€£€0€ €O¡€V£€ €¡€M781 00€¡€°€ €€helix 6Š€£€0€ €Z¡€h£€ €¡€M781 0€€1€0€£€1€¡€FVAST structural alignment for pdb|T079| , mapped to sequence alignment€€¡€1€0€ € ¡€¢€1€0€ €¡€ VAST score¡€ € 00€ €¡€ VAST p-value¡€ € 00€ €¡€6VAST root mean square deviation, measured in angstroms¡€ € 9.10580€ €¡€VAST aligned residue count¡€¡€t£€ €0€0€ €¡€0€ €¡€T079 0 €¡€M781 0¢€0€£€t