¡€0€ €0€ €0€ €Ò¡€0€ €T079£€0€¢€0€ €Protein Data Bank¡€ €¡€0€ €Ρ€ ¢€¢€¡€0€ €PDB¡€¡€T079£€¡€0€ €Ρ€¢€€€¡€0€ €0€ €¢€0€S.Rhee R.G.Martin J.L.Rosner D.R.Davies¡€0€ €¡€0€ €Ρ€¢€¢€0€ €0€ €¡€&Transcriptional Activator; A Bipartite¢€NA§€ÿ¡€0€0€ €¡€0€ € £€SEQRESš€¢€ €¡€T079 0£€0€0€ €¡€ ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€'0€ €¡€ ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€10€ €¡€ ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€%0€ €¡€ ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €¡€ ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€10€ € ¡€ 9 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€ 0€ € ¡€ 10 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ € ¡€ 11 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ € ¡€ 12 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€10€ € ¡€ 13 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 14 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 15 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €¡€ 16 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 17 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 18 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€ 0€ €¡€ 19 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€40€ €¡€ 20 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 21 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 22 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€ 0€ €¡€ 23 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 24 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 25 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 26 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €¡€ 27 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€+0€ €¡€ 28 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 29 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €¡€ 30 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 31 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ € ¡€ 32 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €!¡€ 33 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€:0€ €"¡€ 34 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €#¡€ 35 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €$¡€ 36 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €%¡€ 37 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €&¡€ 38 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €'¡€ 39 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€70€ €(¡€ 40 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €)¡€ 41 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €*¡€ 42 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€40€ €+¡€ 43 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €,¡€ 44 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €-¡€ 45 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €.¡€ 46 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €/¡€ 47 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€%0€ €0¡€ 48 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€(0€ €1¡€ 49 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €2¡€ 50 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €3¡€ 51 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €4¡€ 52 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€10€ €5¡€ 53 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €6¡€ 54 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €7¡€ 55 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €8¡€ 56 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €9¡€ 57 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €:¡€ 58 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €;¡€ 59 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€70€ €<¡€ 60 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €=¡€ 61 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €>¡€ 62 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €?¡€ 63 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €@¡€ 64 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €A¡€ 65 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€%0€ €B¡€ 66 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€10€ €C¡€ 67 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €D¡€ 68 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €E¡€ 69 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €F¡€ 70 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €G¡€ 71 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €H¡€ 72 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €I¡€ 73 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €J¡€ 74 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €K¡€ 75 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €L¡€ 76 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €M¡€ 77 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €N¡€ 78 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€+0€ €O¡€ 79 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €P¡€ 80 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €Q¡€ 81 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€70€ €R¡€ 82 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €S¡€ 83 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €T¡€ 84 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €U¡€ 85 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €V¡€ 86 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€70€ €W¡€ 87 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €X¡€ 88 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€(0€ €Y¡€ 89 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €Z¡€ 90 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €[¡€ 91 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €\¡€ 92 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €]¡€ 93 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€10€ €^¡€ 94 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €_¡€ 95 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€10€ €`¡€ 96 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €a¡€ 97 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€10€ €b¡€ 98 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€(0€ €c¡€ 99 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €d¡€ 100 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €e¡€ 101 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€70€ €f¡€ 102 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€(0€ €g¡€ 103 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€ 0€ €h¡€ 104 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€:0€ €i¡€ 105 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€+0€ €j¡€ 106 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€+0€ €k¡€ 107 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €l¡€ 108 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €m¡€ 109 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€70€ €n¡€ 110 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €o¡€ 111 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€%0€ €p¡€ 112 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€10€ €q¡€ 113 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €r¡€ 114 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€%0€ €s¡€ 115 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €t¡€ 116 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €u¡€ 117 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €v¡€ 118 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €w¡€ 119 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €x¡€ 120 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€(0€ €y¡€ 121 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €z¡€ 122 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €{¡€ 123 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€+0€ €|¡€ 124 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €}¡€ ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €~¡€ ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€70€ €€¡€ ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€/€€0€0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€ ¢€ 0€ €0€ €¡€ ¢€¡€0€ €¡€ ¢€0€ €0€ €¡€ ¢€¡€0€ €¡€ ¢€ 0€ €0€ €¡€ ¢€¡€0€ €¡€ ¢€ 0€ €0€ €¡€ ¢€¡€0€ €¡€ ¢€ 0€ €0€ €¡€ ¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€ ¢€ 0€ €0€ €¡€ ¢€¡€0€ €¡€!¢€ 0€ €0€ €¡€!¢€¡€0€ €¡€"¢€0€ €0€ €¡€"¢€¡€0€ €¡€#¢€ 0€ €0€ €¡€#¢€¡€0€ €¡€$¢€ 0€ €0€ €¡€$¢€¡€0€ €¡€%¢€0€ €0€ €¡€%¢€¡€0€ €¡€&¢€0€ €0€ €¡€&¢€¡€0€ €¡€'¢€0€ €0€ €¡€'¢€¡€0€ €¡€(¢€0€ €0€ €¡€(¢€¡€0€ €¡€)¢€ 0€ €0€ €¡€)¢€¡€0€ €¡€*¢€0€ €0€ €¡€*¢€¡€0€ €¡€+¢€ 0€ €0€ €¡€+¢€¡€0€ €¡€,¢€ 0€ €0€ €¡€,¢€¡€0€ €¡€-¢€0€ €0€ €¡€-¢€¡€0€ €¡€.¢€ 0€ €0€ €¡€.¢€¡€0€ €¡€/¢€0€ €0€ €¡€/¢€¡€0€ €¡€0¢€0€ €0€ €¡€0¢€¡€0€ €¡€1¢€ 0€ €0€ €¡€1¢€¡€0€ €¡€2¢€ 0€ €0€ €¡€2¢€¡€0€ €¡€3¢€ 0€ €0€ €¡€3¢€¡€0€ €¡€4¢€ 0€ €0€ €¡€4¢€¡€0€ €¡€5¢€0€ €0€ €¡€5¢€¡€0€ €¡€6¢€ 0€ €0€ €¡€6¢€¡€0€ €¡€7¢€0€ €0€ €¡€7¢€¡€0€ €¡€8¢€ 0€ €0€ €¡€8¢€¡€0€ €¡€9¢€0€ €0€ €¡€9¢€¡€0€ €¡€:¢€0€ €0€ €¡€:¢€¡€0€ €¡€;¢€0€ €0€ €¡€;¢€¡€0€ €¡€<¢€ 0€ €0€ €¡€<¢€¡€0€ €¡€=¢€ 0€ €0€ €¡€=¢€¡€0€ €¡€>¢€0€ €0€ €¡€>¢€¡€0€ €¡€?¢€ 0€ €0€ €¡€?¢€¡€0€ €¡€@¢€ 0€ €0€ €¡€@¢€¡€0€ €¡€A¢€0€ €0€ €¡€A¢€¡€0€ €¡€B¢€ 0€ €0€ €¡€B¢€¡€0€ €¡€C¢€ 0€ €0€ €¡€C¢€¡€0€ €¡€D¢€ 0€ €0€ €¡€D¢€¡€0€ €¡€E¢€0€ €0€ €¡€E¢€¡€0€ €¡€F¢€0€ €0€ €¡€F¢€¡€0€ €¡€G¢€ 0€ €0€ €¡€G¢€¡€0€ €¡€H¢€ 0€ €0€ €¡€H¢€¡€0€ €¡€I¢€ 0€ €0€ €¡€I¢€¡€0€ €¡€J¢€ 0€ €0€ €¡€J¢€¡€0€ €¡€K¢€0€ €0€ €¡€K¢€¡€0€ €¡€L¢€0€ €0€ €¡€L¢€¡€0€ €¡€M¢€ 0€ €0€ €¡€M¢€¡€0€ €¡€N¢€0€ €0€ €¡€N¢€¡€0€ €¡€O¢€ 0€ €0€ €¡€O¢€¡€0€ €¡€P¢€ 0€ €0€ €¡€P¢€¡€0€ €¡€Q¢€0€ €0€ €¡€Q¢€¡€0€ €¡€R¢€ 0€ €0€ €¡€R¢€¡€0€ €¡€S¢€0€ €0€ €¡€S¢€¡€0€ €¡€T¢€ 0€ €0€ €¡€T¢€¡€0€ €¡€U¢€ 0€ €0€ €¡€U¢€¡€0€ €¡€V¢€0€ €0€ €¡€V¢€¡€0€ €¡€W¢€0€ €0€ €¡€W¢€¡€0€ €¡€X¢€0€ €0€ €¡€X¢€¡€0€ €¡€Y¢€ 0€ €0€ €¡€Y¢€¡€0€ €¡€Z¢€0€ €0€ €¡€Z¢€¡€0€ €¡€[¢€0€ €0€ €¡€[¢€¡€0€ €¡€\¢€0€ €0€ €¡€\¢€¡€0€ €¡€]¢€ 0€ €0€ €¡€]¢€¡€0€ €¡€^¢€ 0€ €0€ €¡€^¢€¡€0€ €¡€_¢€ 0€ €0€ €¡€_¢€¡€0€ €¡€`¢€ 0€ €0€ €¡€`¢€¡€0€ €¡€a¢€ 0€ €0€ €¡€a¢€¡€0€ €¡€b¢€0€ €0€ €¡€b¢€¡€0€ €¡€c¢€ 0€ €0€ €¡€c¢€¡€0€ €¡€d¢€0€ €0€ €¡€d¢€¡€0€ €¡€e¢€0€ €0€ €¡€e¢€¡€0€ €¡€f¢€0€ €0€ €¡€f¢€¡€0€ €¡€g¢€ 0€ €0€ €¡€g¢€¡€0€ €¡€h¢€ 0€ €0€ €¡€h¢€¡€0€ €¡€i¢€0€ €0€ €¡€i¢€¡€0€ €¡€j¢€0€ €0€ €¡€j¢€¡€0€ €¡€k¢€ 0€ €0€ €¡€k¢€¡€0€ €¡€l¢€ 0€ €0€ €¡€l¢€¡€0€ €¡€m¢€0€ €0€ €¡€m¢€¡€0€ €¡€n¢€ 0€ €0€ €¡€n¢€¡€0€ €¡€o¢€0€ €0€ €¡€o¢€¡€0€ €¡€p¢€ 0€ €0€ €¡€p¢€¡€0€ €¡€q¢€0€ €0€ €¡€q¢€¡€0€ €¡€r¢€0€ €0€ €¡€r¢€¡€0€ €¡€s¢€0€ €0€ €¡€s¢€¡€0€ €¡€t¢€0€ €0€ €¡€t¢€¡€0€ €¡€u¢€ 0€ €0€ €¡€u¢€¡€0€ €¡€v¢€0€ €0€ €¡€v¢€¡€0€ €¡€w¢€ 0€ €0€ €¡€w¢€¡€0€ €¡€x¢€0€ €0€ €¡€x¢€¡€0€ €¡€y¢€ 0€ €0€ €¡€y¢€¡€0€ €¡€z¢€ 0€ €0€ €¡€z¢€¡€0€ €¡€{¢€0€ €0€ €¡€{¢€¡€0€ €¡€|¢€ 0€ €0€ €¡€|¢€¡€0€ €¡€}¢€0€ €0€ €¡€}¢€¡€0€ €¡€~¢€ 0€ €0€ €¡€~¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€€¢€0€ €0€ €¡€€¢€¡€0€ €¡€¢€£€0€0€ €¡€0€ €!NCBI assigned secondary structure¢€0€0€ €¡€helix 1¢€€€ €¡€¡€0€0€ €¡€ ¢€0€ €¡€helix 2¢€€€ €¡€¡€0€0€ €¡€)¢€30€ €¡€helix 3¢€€€ €¡€¡€0€0€ €¡€8¢€J0€ €¡€helix 4¢€€€ €¡€¡€0€0€ €¡€O¢€V0€ €¡€helix 5¢€€€ €¡€¡€0€0€ €¡€[¢€e0€ €¡€helix 6¢€€€ €¡€¡€0€0€ €¡€i¢€p0€ €¡€0€ € NCBI Domains¢€0€0€ €¡€Domain¢€d€€ €¡€¡€0€0€ €¡€6¢€€€0€0€ €¡€¢€0€ €QSingle-coordinate-per-atom model from PDB entry T079 with a vector model attached¡€Resolution: 2.3£€ NA NA £€0€ € ¡€ €€0€0€ €¢€ € €0€ €Ρ€0€ €Ρ€0€¢€0€                                             !!!!!!!""""""#########$$$$$$$$$$$%%%%%%&&&&''''''''''''(((((()))))))))**************++++++++++,,,,,,,,---------...........////////00000000000111111111222222222333333333444444455556666666666777777888888889999:::::::::;;;;;;;;;;;;<<<<<<<<===========>>>>>>???????????@@@@@@@@@AAAAAAAABBBBBBBCCCCCCCCCDDDDDDDDEEEEEFFFFFFFFFGGGGGGGGGHHHHHHHHIIIIIIIIIJJJJJJJJJKKKKKKLLLLLLLLMMMMMMMMMNNNNNNNOOOOOOOOPPPPPPPPQQQQQQQQQQQQRRRRRRRRSSSSSTTTTTTTTTUUUUUUUUUUUVVVVVVVVVVVVWWWWXXXXXXXXXXXYYYYYYYYYZZZZZZ[[[[[[[[[\\\\\\\\\]]]]]]]^^^^^^^^_______```````````aaaaaaabbbbbbbbbbbcccccccccddddddddeeeeeeeeeeeefffffffffffgggggggghhhhhhhiiiiiiijjjjjjjkkkkkkkkkklllllllllmmmmmmmmmmmmnnnnnnnnnnnoooooooopppppppqqqqqqqqrrrrrrrrsssssssssttttuuuuuuuuuvvvvvvwwwwwwwwwwwxxxxxxxxxxxyyyyyyyyzzzzzzzzzz{{{{{{{||||||||£€0€                                                                                                                                                                                                                                                         ¢€0€ €血0€å) üIÉo˜ 2ü ýücÂú'ô²ñŸîšñÈëéòÓèžòbïò%ïŠï ìÕôh÷Túùøˆ ]èÿù÷þò”ñqøŽþ ^¶pïIê éØè*æ\áöë}ë×îì~ï?í!ôèçIñÌóßïQîà÷šý¡þâØëÝç ä"â”äYçwêçYâòߍáëßÞTÚÁÕjÜ.Ór׆àé×|àÞÜ-ç"ééç]ïqðòõ«ê‰êBä•ãBìŠñ²ö\÷éø€á8Û£ÙàÕ:ØÃ×Օ×CݪÜbߌÝVÜ­×l֗ÓÙä¥ç·ä°ã}í î&ðGò*ãfà{܂ÙòÝØ߯ÜyØèÝlÛåØ­Ù¢Ú ÒÙÐ#ÚMÛàãºÛ-ÜØÚ¥ßðä„ç©ëçãݬ݄܃å—èXìÛñTêmç­ë–ïrð(ìÇíªè@èä#ônõ¥ñðúbþ1Zÿ$üî)éšå{ä.ç™äxçä*ÞÔãpßbáÝéÞ1ÛaÚÖæèè ç]íqîxèÎè ãhãhéMå²â­äóÝýßÙ€Ùg×_ÕÊÔòÏŸϬÍ1ʋÍeÛ`ÛYߨäjÛr׬ހâeã˜àèŠê€ëÎérïšïGîGðíúïÔîÐîaïwñGõ÷þôøðõOøŒþUø‚ùãùùôañ3){Q o¯p[5JíüèþŒù”úijÑ} þ‹ÿŸûÍþGþýp‰Dù$÷—÷%òyó Ïé ”Z =Ù‡kÖŒ»–>õ}‘ó  ø yž,ýûÛ & ãŸJŸe ‹É Ko£,êÓò"ã#ê(­(µ-€°‰˜Þf‚ÔM·[ vQbÍ@« ³á’ ÿ%ò%5(ï E˜[…4ÚÒ¬;Ð+!‘ ß ^ïìãýSW Ä  ' D1b%#à&]&)4  q@ S Ë íŽ­ŸÞûªþ?üpùªùzq± { Š   ɳD Ìœ à ˜‘a‡‰;Æð0{(ü!óþüù2þ+ûO÷)õxð‘îãT· f  ù Ž Ÿ¿  ²ŸÀ  , ç"üúÛø”÷°÷`òîóü$ûWþòý×ü ødý#ù X,Zp OÉÄüûDÿš*ÿwÐùôöGóÊðŽìÔécæÔè*ú|ü?ý÷þÙãüÃÿLHýmýÿb ûƒù“õÛð—ìÚôøøÁþI ÔðUëvìgðºè è$è%è…å¶äùæäê<éîžäMáÒåéšámÝnޖßôÞâÿååèkæ)áçܵݹíïÂìãí›õlõÄ÷|û8éŽæªâ·á®ãŒâ¿ݗâ«àŒÜÏßmÜôÙÉ؄Ü>Ó²Û(ҋÖPÕ8ä\çGèÉèâì0ëuðœé£êëiæñç±ìŒâCÝVÛ²Ù÷ØûӝÏŽÑ4Ë(ÜDÚŽÞBÜ¢Ú¢؋ÜÞÞ ÚÚÖ܃ã)æZç2êoë›ë8éÿìé—ëžênêOäŒä~ç¡è`é`ì‘é#å‰ðpôUøÓógü4öŸû#êZçKç×å!èÛæUà_ÝÃÞHëdìðòí‹òóð©ôEùÜý6ó@ö4õCò!÷óú¿ËÔbÿhýŠ÷èôëöVþy­yûƒû¿ûßþźÐû•üàþøBó Te ºÄ ú“e‰ 'hM… É‹cgÿ . Ý þÉ\6 Æ fÙ ðf þWž"Ê'Í$Y%ð+”.É!I${%])z!Ä"=#j!e!™!õ$'{köÕßœDÝ#Ÿ%­)å,ž!ãõžéŽ*=.,š/Ì3”5µ5õ7'•%mÐ%#*~s£’› 4~ Ÿ Þ ñ’W î , = ô kˆ³°œPp‘xˆ!B%'³*³ÅþÛÚŒ¥"ˆéª  B ®üðùJõRô`òF#Œ-ÇŒ °-Üä  ß¹!ÅO8#.!¥ ;…(<,š+€,Š1589Š6)†'ï$Î ±$Œ&h+A*Û/Ý&ì$z"a!" #\"+»• q'“+-(I$ú.¶2)£'Ì"F )(u-R.â2Ù4²2Ö8HùÊá@lê(g÷"i;œw N•ŸiW• Ê f 3  l š ց%«ýÅüàÏð Ð ?¶JU–¢€0€Œ¬‹ñ‡ž…l‚Q†Á“☊š<›`š0›¶—Ú™‹œ|3—è˜>’ÂŽïí.‰Ì…»ˆ4Ó‘·ÿŒž‡Ž‚ê–y›U›=ž. 5¢FŸ §(¡Ëг——“”p•w’éŽ;Š7ŒyŠü…—€¬†b€J’ê•‚”Ÿ—1–Ä–ž˜“›-—4—šžº£;¢l§‘“;[‹˜Šý†÷‡Iê‚ŸeOzezRw댓ŠHÑŒ‰1„œ‡òƒœ’Å–K–ì—䛘#™Á™p—m–\–‘\1—™NŸµŸeŽ@‰2‡š‡æ„ôƒô…\†.„„J€A†ÅŒ¬‹{‰Št†f‡#Í“֓됛—J‚5~ytÙy} ybtÎr tZvÑ|S~,miæjçhÊdbá]2f•n,oƒk¶mIuxSf¹bãc,e]r\Vg]'aaP_™aœ]É_Ãd%hscC[ŸY€]Ø_ÎT·QRLGíIÔ_NcbhjÅe jG`äim…l)o’nÝt&ge f{hí_\(W{S(XdìeÝj¬j¥fŠldmOk>m|qökEnÚsos]tDwòvîrqçlsiJk[f‡bLbKgÖlâqŠlâvBq}v/zœ^­ZK\F` V#XY­[Ÿ\‚`ŠWåRmNõM¶L^XÈY ]Æ`HTOMKhHCG*K8BÙFßBÇ_ch®kæc9gqhk:ln i‡n%o>s¥m0qÚvºp³k%k«m­qTfvdI_œ`g[k&lÊr§u i™i'fŸa ]D^[XRtGyŽ}q€éznxax@~t|Œš€„9}$€<€T‚É‚ç…f…o{ã|2̓Pvßw6zgx„rŒ~ŸÖ‡WŠê€‚ ‚w€†‡ñU•Œ[‘––/ƒÅQޝ‘\bА:Š[ˆ-…›„…ƒ~3~\‡"Št»‰‘âŽ0yåu%v5x\p®qtœuµsÏvÒrûuÑrGzÛnælµp q?q„ttz;|ìsÊxÆw¹zŸs—|#|Â…ƒ$ˆ*Œðˆ‘ Œ¯‘r•í~~*}¿€yyºzqy–uÏz5y[~§tqq_k|iýkknRj"€k…‰lŒ†Ö‚≊sŒm§>•˜šØ›b‡t††ýˆÇ€gcy¹x”s…͆šŒiŽSƒ¶}œ{^y]”î—Wš——ǝ••“—©– ™ •Ԙɜ™å ë‘0^’D’ô‰Ž†ƒ‡å€Š“ç–œœ=ž—žä€'€?šŠj¥ šñ§ú­d  Ÿ¢ž3Ÿ¬›_˜h™Ežx›;™ôžàŸ/–ZïŽNâ¢Œ§p«è¯‘©¥mš\©®ˆ«³°®­±®±ˆµ‘³²³²Äª šC£ï¡Ù¥ð ^¢Rž-™%•ŽŸðœá˜VŸ1˜›“ď1Žã“©—c˜Ü•R’‹©‡„ƒ–ƒÄ†U‹ç‚gzpxÀ~xa vìw÷sŒu¶sqpjŠii:z1|#}Õ~€­„Óˆ”„ÍŒFˆ|Œ0ÏH€ø|,|CƒÕ‰R‹IwúsqMp\opÏorœqnÏlÌl»n,k?wÄ{Ÿ| }Ü€õ…œ‰°‘À‘Õ•žzuz¬uctô}6ƒ…Í…È‹<‹5é“@q_l_hdhßeatc0gókPi!p…kñsjq$\pXXØVSQZQ·N(U\$\©`ÜcpWjV©a™ehc—f”f%jœklhŸo-^™\\w]˜ViUŸW&WþWh[†[çazbJZT‚\¡eLjÃlcosnZt#v"w)jŸk¡iálÚh²iÆj@ecPf,g<][£UÃSœNœK}LøgLj2oÑqÙj—f†ožrhww~zšyžy‚:‚>‡œ‡£ŠWs¿s rjtfn]lŽn¹m/q­onBssžiàdØdÁ`‘vƒzú™‚°|†&€Š:„‰€ „‡ƒ†Š‡Šr ‰.’MŒx‘ ~|M}ø~ ~+{hv{~2,€Ì~ú€†Èˆ4‰|z;~êƒ0wu“zh~‚]…—Š`›zhyƒ†)‰€ŽD‚›…ž„FŠ˜ˆ‹ü‡‰ÖŽ[’š†ˆ^„b|¶w‘¯•öš–“c—“tš£—š›ž5”Y—û›Ê q”ö—æ™a•”Œ˜?i™ÙŸoŸÒ™¡–X™÷¡£pš§ÝŸŸŸ›@¬]±?±3±Zµÿ¶$·ÜŽs°á±®¯Ý¯³`°ñ²t©'¥Í©H«M¡!›º™€—Qšhª$­­«=Š•®›­K©2§`²=±µV·¶‡§æ£òŸœ¿¢cž%Æ™D™Ê–!”“úŽcì‰I„èˆùžMžêžà¡K€€ B§ê Pš€Cœœ=Ÿž–³–™~Z¢Š¥R£À¢l«¬Ã¯U¬°—®ð€*¢×¡Ÿ{§qš/ŠŽ¡Ÿ:›Â–ï£ô§î­kŠÝ£€0€!Œ'J*Ò.F)<$÷!§$ÿ)Ï,ä.82¿* *P+%.¶2%Õ&Ì"*&`.1,6h:i.!1M,?6g;H>ÑCx:ƒ8Ô?<\<?kAÓEv;ó;ø<Ç;iâe5m|g³h·kkecbüg^‡mo7txikh^cÛk!s¥x0}.tyv¬zárg~­ƒh…*‰‚цŋ°Œ‚U„7:ƒu„ˆ|(xÿz3|/shsäyxðyt+s}y€{ô}΀xpÁkèjliâl;h®iŽh b0_}i]gneœk¬`1Z”W&RÕY£UšW×XeY(YV?V!RXÜU8TtW‡XöZ­ZíWŸUJ`Ž`þc_W©TºNóK•V©UžMâH–FAíHŠDÏG#GxH‡HŽF«C^?K/LÇOTóY Xj]ÂE]BO>K?ŽFIý9j5Z3H2J2Î0•4¬8ä-›*˜-%8*3"V$×!ö3J6Ÿ:š9°3Q1}?C=AjB’G¿F9KL™H >m<€8ù99Ž<@|;B?8?98;;Ë5Ð2C5%4».)ò'([#Ô$—7à;)=ÿ>^?,B‘??E]?úB¶?@kDÓI:KÊN:K1:‰6’5t621l-Í(r(œ)I)p)¡3×2u6Î5ò1F,,.ê;r@9A×C®DšI‹M"JËQØO‡SAUB©>õ@‹BTC‡HaKcL39ô5ú6E50–-”(†#§ù7ð8F<í§r¥;€nš_Ÿß²%Ž?žž:°°hºŽŸ|œÀ=Ã×Ç È÷É6ž¶`ž!¶Ô°v®1š”¥s§M»7œ žˆŽI¿ó¿œ]¹pµT³{¯¶Öž”»¹í¶ÐŽË°ñ¬ç¹%žJºÆ²²®i©c¥B°Ÿ¬Â«Eª0§hŠL€ß¡©Ô¥5¢HŠÏ©«O€ç€º¢'ž­šŠI ûž[™ã•Ä¢— ê¥v©ç€œšÇ—’DŽ ™÷—”×÷˜è— ›Ø’³û‹Œˆ Žû“Šj“tŠPŽÏŽœŠÄ.ŠÀ‘ñ”“—»š^˜•"’ý”ÌçŽÄ—š% ¢Ú˜L“*“/•fí¡å§›©6¥ð©ó©²®>°B¯‰­öµýž:œ÷ÀbÀ3°œ°HªÍ©þ±â·•žuŽÊœ\§¡‡ #\óY˜£¢¡€)¢G¢w¢šF€Ô© ¬]©­©j±‰³Ôµ[§•€áŸÁžŽ£ÚŸwŸ_œ÷a #›#œ§—Ƙù–u”Ÿä‘‡œšž%ŸÑö¢·£ŸéЬ Q§£Û£G¥¢¡r¡æ©YªØ°±3³w™•j’ý–™ Æ–?•<‘¿”k‘ƏՌ¯†ÎŠƒ(„ԁU™£œÃ Â¢“Ÿ­œOš0›\—˜@–(¢.Š«š¯H€›ŸÁŸµ›ð¬4±°É¬õ±“¶ó°á޵Ž»ŽÒ¶$¹£º±¹g³í³šž”žN±ï¯á³XœÁžÃ.ÄÆ7ÊÆÏÙËÒøÐ%ÃyąÀ”ÁøÄOÆ.ȂÄUÆŸ»¢·Å¹·ù²I­Â¬®ª“š Ќ¥”¡v»OŒ•ÀÉÀŸ]Â/¿»¿áŒ¬¹;ŒïĔÉÈ«̞Î ΠÓEϳÄêÀ1»ÝÁgŒžÅR¿1ºÂ¶1ÂÙÇûÈÌGŒ+žp³¯6»ŒíÁßÇÃŽ]¯ü¬K­ã±ï°²ó·$°€§|£Âž¹žsšœ•¡’òŽ®’Q\Œõ‘ˆ~•“Ä‘~”˜c—=Œ„‰`‡/„׌bÒ‘•S–ò”Ëš ‡¿…·Æ}b‡zŒÛŠŽ>•~“<–Ù}\w«v@xtuo«l‰nJr“qhlhŽqçw€y€{y~zÇkÃg^a»^¢gjmoö`$Z¬Y¬ZVñWîW#Tc£€ €0€ €血0€!~„ óõœ1nÀYÐò¡àáôØ*Çì Mñ%¶ðŸœ ÀÆÚÝØ·æOùtën©}ҁñS²ÕâÌÆÉ²˜º+‚éö]DØ,SuoO(YE|ZõŽê°ØýÜ àáð–Ï֛ÕÀæ2Áç«h¡ê–ÔÆÆÉå¯äRɚ€£yšÛBÏ­y®°âJ*ñ}ó3Ù›‹»±ÉÂØ®šÎÒŸêVۈæ•ÎóÒ ÖÉ]Ÿ°¹‚•Í—,˜ÆŸÍž=€ªF€¹ª<·ÔâàÄ̳_šòãíï¥Â$é4ÿEõcý>ۈ6(ý¢ô¯S^ZO/\.öåúYËéü±D§€î~ôîevÔXµþ»9¢2ùº>o­eԓß _çrŽè/ãÏÁyžiõÇÉq-6¹FÉ®΀û?µ@ىÚ’¶Ï¿óªïÄ­šoãšõ”û÷è&“DŒ ˜Æ™ ¹æƵé¢ì|ÐÊɚÛöЄŸPäÔΙàÏv†-Þ%ØübҌԓÕâÚ¢ÇÎþ¯ÝËãþÿêαøäµåùtç·æ;ûšZ®„3y9 vó>hDöBa<­„fz3la;;à‡äo üÖ.Èäfæcÿ  B"æøŠ0Í$ÚyÎ6û üb÷ÖÝÂÍ ‰?ðû]ß>î3é¶ò0ÿc؇Çê°-™ç]¹c©Æ Î+ó˜á– .ñ™Î§§µ Û¥åÎÆ ŸÈú‹áŒž*®‘µ­¶²yœ+¥m³õŸöž¿sÛ|`{=N§Œ—…òvެ0«6”„Ÿ<ó»¢áÇý>Ö.ôU 3æúº†šòʉ·À­ŽŽ ‹d'ž’žœÖžñÕéÝÅ»ڎâ†Ø§§ŽŸœ¥œœŠ^_}œ«hwBÜPÏœÿÛ#ãDs *É.Æ×FãÆýÔæZðö{3%Ε!ö†Ö¯äûßÊñþÞÓžÂØó>Èœ·=Á¬Ä€ÒÓ{áù¹Z¹€ŠÍ1ٔÿE· ýòԓ©7œ7€Ø‘‹dågÉ«é$®s‘Ò±ŠÊvʼnÜŽ͂Úèÿæî¿‡Z°"šòš¯bDf%u%lQšŠ„M…f•’Ž÷n‹i³žŽSƒ`ß0‚Ÿ‚Z<uwL£Â8³¹Š­ŽÐƒ,° š¡wì– Š¯ðŽ9n•ˆIŸ.ƒê‡Œ=²ytqÔDŽ”už€LŸˆZÜMî„“Œå”Ó²¿k÷œîo5-WI¢|‡|jƒ ™ƒ={û»‰ Ÿ=~J€„²ëcôáʝú•X)g¿­eaÙgüK–Uѓ䘝‰‰Ãùƒ{¥ŸyÌ“²ŸœŠþÇŠÃ;ÖºŸ¥y ŸÞ}1~˧»Ú ¯m†$h¯[ƒ^\UnÈhöˆ,Ž‰&³~ŸëÒªòa̰æï€s²ÞºIÝ+©Šâ! ¶þ× @§&ŠÝ›Z¹Ž·Ý‹â€>}ÈŒO…* ªèßʈ!r-vo«…kvóû³>—„§|’Á•`™ƒpƋאˆ“ž¥'ÙN—{Š,ZŸ<vò}c‰€¬š—Ð ׌ž’`|ºuäÓœTИå’.%¿|:1('•„ÐpXnï `"fÏIÉdZ|‡ƒ!›©Ð\J¹Ø ð‡ ³~nŽÒøñý3þ}úE΀ —à€Ćžê}ù¯"ÈÆf•‡{p‡;—àdPZ–f%VÁNeb¬T›Œ\€WÙŒ ±*fÙ“Š‚P~JT×]„nïk0„íŽC‰€{¶§ÇiÂÄã/ §üšîÙ÷»Úž\œT]£Šžxæ”[›•²ò²eäG„žâRƆ~±s‹ª1€LÒ2–%†`p/Í}щ&šRow’t®’\ÆV7ù^tvòX˜…R•Ä{î” ™Ô®‹Š€‡dwZoØ©UÆR”¡”µzW›‹‘{Ôrö‰”˜Cÿ†‡vynsŽe^—®kŒ©…o™Ž°?€~£¬‘š¬Á„¶a™[oÕ„ŠԞw¯Šrœ_Ñ¥|j_(m.sÇP7‚I)No;’F'_2q—v„iÜiYpãuNƒ^xFŸ‰l€«b—w.~®€¶z퇎ÃFW¬Ð’rŠ—w¥pÆ[|jÁŠcLY8a²v¿ož{À]—qq—klŠƒg[X^U—Õ{”RŠÉ‹«Iº@¬˜u¥ —!‹|õ‚'î>ãžá ٝ}©nŸ„D¥xc{Êx 1VD\Kbpƒr€L‡Ç‹U–æށ­Qnx·Ž å©„u¯w©t™)Û×µ|Ȃn(¥ —³ìá2”[â,›©÷”µ-Ì)vŠ(^æ'-S;;>\'1Qu;nYçMpOnVøhðŽœAÂ8WC(Iö†üMÐe›˜/©ŠŠg_> LFq©7·ÝÍ< ¬WœÈ揫— ‰:“vW•Ø{„¶žŽÙ§/•‘³¯P󬁑eþpíjI†~`5v ÆGŸK²eµà¥ï·¬ºq‹ºÉ»kÑL¹Z¶«àºÖì«à²òÕ)á2JÈ…š§ãû"ÞDßãÚ®s× ¢©0€ €¡€0€€€helix¢€ €¡€0€ €¡€¡€0€0€ €¡€ ¢€¡€¢€0€ €0€ €B@¡€‰A¢€:H0£€‰X¡€0€ €B@¡€ì1°¢€H€Ð£€ŠbP¢€0€ €¡€0€ €¡€0€€€helix¢€ €¡€0€ €¡€¡€0€0€ €¡€)¢€3¡€¢€0€ €0€ €B@¡€l'€¢€Ö@£€ѐø¡€0€ €B@¡€쇠¢€`$p£€Ëÿ0¢€0€ €¡€0€ €¡€0€€€helix¢€ €¡€0€ €¡€¡€0€0€ €¡€8¢€J¡€¢€0€ €0€ €B@¡€âaø¢€’fÈ£€¢]@¡€0€ €B@¡€?Ä8¢€žÃð£€RÈ¢€0€ €¡€0€ €¡€0€€€helix¢€ €¡€0€ €¡€¡€0€0€ €¡€O¢€V¡€¢€0€ €0€ €B@¡€‡M¢€Æ `£€=P¡€0€ €B@¡€¡Qž¢€êµ£€³`ž¢€0€ €¡€0€ €¡€0€€€helix¢€ €¡€0€ €¡€¡€0€0€ €¡€[¢€e¡€¢€0€ €0€ €B@¡€•/h¢€Öࣀ=ò8¡€0€ €B@¡€ÜvX¢€mÀ£€…8P¢€0€ €¡€0€ €¡€0€€€helix¢€ €¡€0€ €¡€¡€0€0€ €¡€i¢€p¡€¢€0€ €0€ €B@¡€P'ˆ¢€‚»£€ÞI¡€0€ €B@¡€@l0¢€ÜYP£€ŸpÀ¢€0€ €¡€¡€1€0€ €0€ €÷0€ €M797£€0€¢€0€ €Protein Data Bank¡€ €¡€0€ €Ρ€ ¢€¢€¡€0€ €PDB¡€¡€M797£€¡€0€ €Ρ€ ¢€€€¡€0€ €0€ €¢€0€¡€0€ €¡€0€ €¢€0€ €0€ €¡€Casp3 Model Structure¢€NA§€ÿ¡€0€0€ €¡€0€ € £€SEQRESš€¢€ €¡€M797 0£€0€0€ €¡€ 1 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€'0€ €¡€ 2 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€10€ €¡€ 3 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€%0€ €¡€ 4 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €¡€ 5 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 6 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 7 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 8 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€10€ € ¡€ 9 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€ 0€ € ¡€ 10 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ € ¡€ 11 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ € ¡€ 12 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€10€ € ¡€ 13 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 14 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 15 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €¡€ 16 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 17 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 18 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€ 0€ €¡€ 19 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€40€ €¡€ 20 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 21 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 22 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€ 0€ €¡€ 23 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 24 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 25 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 26 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €¡€ 27 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€+0€ €¡€ 28 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 29 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €¡€ 30 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 31 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ € ¡€ 32 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €!¡€ 33 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€:0€ €"¡€ 34 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €#¡€ 35 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €$¡€ 36 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €%¡€ 37 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €&¡€ 38 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €'¡€ 39 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€70€ €(¡€ 40 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €)¡€ 41 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €*¡€ 42 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€40€ €+¡€ 43 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €,¡€ 44 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €-¡€ 45 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €.¡€ 46 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €/¡€ 47 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€%0€ €0¡€ 48 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€(0€ €1¡€ 49 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €2¡€ 50 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €3¡€ 51 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €4¡€ 52 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€10€ €5¡€ 53 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €6¡€ 54 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €7¡€ 55 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €8¡€ 56 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €9¡€ 57 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €:¡€ 58 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €;¡€ 59 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€70€ €<¡€ 60 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €=¡€ 61 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €>¡€ 62 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €?¡€ 63 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €@¡€ 64 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €A¡€ 65 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€%0€ €B¡€ 66 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€10€ €C¡€ 67 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €D¡€ 68 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €E¡€ 69 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €F¡€ 70 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €G¡€ 71 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €H¡€ 72 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €I¡€ 73 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €J¡€ 74 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €K¡€ 75 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €L¡€ 76 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €M¡€ 77 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €N¡€ 78 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€+0€ €O¡€ 79 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €P¡€ 80 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €Q¡€ 81 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€70€ €R¡€ 82 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €S¡€ 83 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €T¡€ 84 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €U¡€ 85 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €V¡€ 86 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€70€ €W¡€ 87 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €X¡€ 88 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€(0€ €Y¡€ 89 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €Z¡€ 90 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €[¡€ 91 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €\¡€ 92 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €]¡€ 93 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€10€ €^¡€ 94 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €_¡€ 95 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€10€ €`¡€ 96 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €a¡€ 97 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€10€ €b¡€ 98 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€(0€ €c¡€ 99 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €d¡€ 100 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €e¡€ 101 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€70€ €f¡€ 102 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€(0€ €g¡€ 103 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€ 0€ €h¡€ 104 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€:0€ €i¡€ 105 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€+0€ €j¡€ 106 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€+0€ €k¡€ 107 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €l¡€ 108 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €m¡€ 109 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€70€ €n¡€ 110 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €o¡€ 111 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€%0€ €p¡€ 112 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€10€ €q¡€ 113 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €r¡€ 114 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€%0€ €s¡€ 115 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €t¡€ 116 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €u¡€ 117 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €v¡€ 118 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €w¡€ 119 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €x¡€ 120 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€(0€ €y¡€ 121 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €z¡€ 122 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €{¡€ 123 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€+0€ €|¡€ 124 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €}¡€ 125 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €~¡€ 126 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 127 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€70€ €€¡€ 128 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 129 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€/€€0€0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€ ¢€ 0€ €0€ €¡€ ¢€¡€0€ €¡€ ¢€0€ €0€ €¡€ ¢€¡€0€ €¡€ ¢€ 0€ €0€ €¡€ ¢€¡€0€ €¡€ ¢€ 0€ €0€ €¡€ ¢€¡€0€ €¡€ ¢€ 0€ €0€ €¡€ ¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€ ¢€ 0€ €0€ €¡€ ¢€¡€0€ €¡€!¢€ 0€ €0€ €¡€!¢€¡€0€ €¡€"¢€0€ €0€ €¡€"¢€¡€0€ €¡€#¢€ 0€ €0€ €¡€#¢€¡€0€ €¡€$¢€ 0€ €0€ €¡€$¢€¡€0€ €¡€%¢€0€ €0€ €¡€%¢€¡€0€ €¡€&¢€0€ €0€ €¡€&¢€¡€0€ €¡€'¢€0€ €0€ €¡€'¢€¡€0€ €¡€(¢€0€ €0€ €¡€(¢€¡€0€ €¡€)¢€ 0€ €0€ €¡€)¢€¡€0€ €¡€*¢€0€ €0€ €¡€*¢€¡€0€ €¡€+¢€ 0€ €0€ €¡€+¢€¡€0€ €¡€,¢€ 0€ €0€ €¡€,¢€¡€0€ €¡€-¢€0€ €0€ €¡€-¢€¡€0€ €¡€.¢€ 0€ €0€ €¡€.¢€¡€0€ €¡€/¢€0€ €0€ €¡€/¢€¡€0€ €¡€0¢€0€ €0€ €¡€0¢€¡€0€ €¡€1¢€ 0€ €0€ €¡€1¢€¡€0€ €¡€2¢€ 0€ €0€ €¡€2¢€¡€0€ €¡€3¢€ 0€ €0€ €¡€3¢€¡€0€ €¡€4¢€ 0€ €0€ €¡€4¢€¡€0€ €¡€5¢€0€ €0€ €¡€5¢€¡€0€ €¡€6¢€ 0€ €0€ €¡€6¢€¡€0€ €¡€7¢€0€ €0€ €¡€7¢€¡€0€ €¡€8¢€ 0€ €0€ €¡€8¢€¡€0€ €¡€9¢€0€ €0€ €¡€9¢€¡€0€ €¡€:¢€0€ €0€ €¡€:¢€¡€0€ €¡€;¢€0€ €0€ €¡€;¢€¡€0€ €¡€<¢€ 0€ €0€ €¡€<¢€¡€0€ €¡€=¢€ 0€ €0€ €¡€=¢€¡€0€ €¡€>¢€0€ €0€ €¡€>¢€¡€0€ €¡€?¢€ 0€ €0€ €¡€?¢€¡€0€ €¡€@¢€ 0€ €0€ €¡€@¢€¡€0€ €¡€A¢€0€ €0€ €¡€A¢€¡€0€ €¡€B¢€ 0€ €0€ €¡€B¢€¡€0€ €¡€C¢€ 0€ €0€ €¡€C¢€¡€0€ €¡€D¢€ 0€ €0€ €¡€D¢€¡€0€ €¡€E¢€0€ €0€ €¡€E¢€¡€0€ €¡€F¢€0€ €0€ €¡€F¢€¡€0€ €¡€G¢€ 0€ €0€ €¡€G¢€¡€0€ €¡€H¢€ 0€ €0€ €¡€H¢€¡€0€ €¡€I¢€ 0€ €0€ €¡€I¢€¡€0€ €¡€J¢€ 0€ €0€ €¡€J¢€¡€0€ €¡€K¢€0€ €0€ €¡€K¢€¡€0€ €¡€L¢€0€ €0€ €¡€L¢€¡€0€ €¡€M¢€ 0€ €0€ €¡€M¢€¡€0€ €¡€N¢€0€ €0€ €¡€N¢€¡€0€ €¡€O¢€ 0€ €0€ €¡€O¢€¡€0€ €¡€P¢€ 0€ €0€ €¡€P¢€¡€0€ €¡€Q¢€0€ €0€ €¡€Q¢€¡€0€ €¡€R¢€ 0€ €0€ €¡€R¢€¡€0€ €¡€S¢€0€ €0€ €¡€S¢€¡€0€ €¡€T¢€ 0€ €0€ €¡€T¢€¡€0€ €¡€U¢€ 0€ €0€ €¡€U¢€¡€0€ €¡€V¢€0€ €0€ €¡€V¢€¡€0€ €¡€W¢€0€ €0€ €¡€W¢€¡€0€ €¡€X¢€0€ €0€ €¡€X¢€¡€0€ €¡€Y¢€ 0€ €0€ €¡€Y¢€¡€0€ €¡€Z¢€0€ €0€ €¡€Z¢€¡€0€ €¡€[¢€0€ €0€ €¡€[¢€¡€0€ €¡€\¢€0€ €0€ €¡€\¢€¡€0€ €¡€]¢€ 0€ €0€ €¡€]¢€¡€0€ €¡€^¢€ 0€ €0€ €¡€^¢€¡€0€ €¡€_¢€ 0€ €0€ €¡€_¢€¡€0€ €¡€`¢€ 0€ €0€ €¡€`¢€¡€0€ €¡€a¢€ 0€ €0€ €¡€a¢€¡€0€ €¡€b¢€0€ €0€ €¡€b¢€¡€0€ €¡€c¢€ 0€ €0€ €¡€c¢€¡€0€ €¡€d¢€0€ €0€ €¡€d¢€¡€0€ €¡€e¢€0€ €0€ €¡€e¢€¡€0€ €¡€f¢€0€ €0€ €¡€f¢€¡€0€ €¡€g¢€ 0€ €0€ €¡€g¢€¡€0€ €¡€h¢€ 0€ €0€ €¡€h¢€¡€0€ €¡€i¢€0€ €0€ €¡€i¢€¡€0€ €¡€j¢€0€ €0€ €¡€j¢€¡€0€ €¡€k¢€ 0€ €0€ €¡€k¢€¡€0€ €¡€l¢€ 0€ €0€ €¡€l¢€¡€0€ €¡€m¢€0€ €0€ €¡€m¢€¡€0€ €¡€n¢€ 0€ €0€ €¡€n¢€¡€0€ €¡€o¢€0€ €0€ €¡€o¢€¡€0€ €¡€p¢€ 0€ €0€ €¡€p¢€¡€0€ €¡€q¢€0€ €0€ €¡€q¢€¡€0€ €¡€r¢€0€ €0€ €¡€r¢€¡€0€ €¡€s¢€0€ €0€ €¡€s¢€¡€0€ €¡€t¢€0€ €0€ €¡€t¢€¡€0€ €¡€u¢€ 0€ €0€ €¡€u¢€¡€0€ €¡€v¢€0€ €0€ €¡€v¢€¡€0€ €¡€w¢€ 0€ €0€ €¡€w¢€¡€0€ €¡€x¢€0€ €0€ €¡€x¢€¡€0€ €¡€y¢€ 0€ €0€ €¡€y¢€¡€0€ €¡€z¢€ 0€ €0€ €¡€z¢€¡€0€ €¡€{¢€0€ €0€ €¡€{¢€¡€0€ €¡€|¢€ 0€ €0€ €¡€|¢€¡€0€ €¡€}¢€0€ €0€ €¡€}¢€¡€0€ €¡€~¢€ 0€ €0€ €¡€~¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€€¢€0€ €0€ €¡€€¢€¡€0€ €¡€¢€£€0€0€ €¡€0€ €!NCBI assigned secondary structure¢€0€0€ €¡€helix 1¢€€€ €¡€¡€0€0€ €¡€ ¢€0€ €¡€helix 2¢€€€ €¡€¡€0€0€ €¡€¢€%0€ €¡€helix 3¢€€€ €¡€¡€0€0€ €¡€2¢€?0€ €¡€helix 4¢€€€ €¡€¡€0€0€ €¡€B¢€I0€ €¡€helix 5¢€€€ €¡€¡€0€0€ €¡€O¢€V0€ €¡€helix 6¢€€€ €¡€¡€0€0€ €¡€[¢€e0€ €¡€helix 7¢€€€ €¡€¡€0€0€ €¡€n¢€u€€0€0€ €¡€¢€0€ €QSingle-coordinate-per-atom model from PDB entry M797 with a vector model attached¢€X-Ray Diffraction£€ NA NA £€0€ € ¡€ €€0€0€ €¢€ € €0€ €<¡€0€ €<¡€0€¢€0€                                             !!!!!!!""""""#########$$$$$$$$$$$%%%%%%&&&&''''''''''''(((((()))))))))**************++++++++++,,,,,,,,---------...........////////00000000000111111111222222222333333333444444455556666666666777777888888889999:::::::::;;;;;;;;;;;;<<<<<<<<===========>>>>>>???????????@@@@@@@@@AAAAAAAABBBBBBBCCCCCCCCCDDDDDDDDEEEEEFFFFFFFFFGGGGGGGGGHHHHHHHHIIIIIIIIIJJJJJJJJJKKKKKKLLLLLLLLMMMMMMMMMNNNNNNNOOOOOOOOPPPPPPPPQQQQQQQQQQQQRRRRRRRRSSSSSTTTTTTTTTUUUUUUUUUUUVVVVVVVVVVVVWWWWXXXXXXXXXXXYYYYYYYYYZZZZZZ[[[[[[[[[\\\\\\\\\]]]]]]]^^^^^^^^_______```````````aaaaaaabbbbbbbbbbbcccccccccddddddddeeeeeeeeeeeefffffffffffgggggggghhhhhhhiiiiiiijjjjjjjkkkkkkkkkklllllllllmmmmmmmmmmmmnnnnnnnnnnnoooooooopppppppqqqqqqqqrrrrrrrrsssssssssttttuuuuuuuuuvvvvvvwwwwwwwwwwwxxxxxxxxxxxyyyyyyyyzzzzzzzzzz{{{{{{{||||||||}}}}}}}}~~~~~~~~~~€€€€€€€€£€0€                                                                                                                                                                                                                                                                                    ¢€0€ €血0€­ÐX¬„ þ ^ e¬ÈDЧ¯Jã-Ÿ€Œ  Åñ›÷Žªû ý¥ñHýµýp”û % “ BH¹/T$&/&³ " Ì&žá\þFI U›  "ÄWó™L "ë"¬'*4 ç ð S…2žU {8Þ 8ÇÎ1ËÒ!ì"¯Ê§®eŽRd BB'õýþúþ×ùîùêöà … œ§ )†¡ÏŒ\ ©.ç 7ã…G/ýgÕ)ÿKŒûÆý÷,T õJè]ãªþüIå-‹ ì m®  •p Ë ûŽúÌ÷ö÷Çò3îVîëýCüŠÎþ.þTû›÷«ý¹[x¢ Ü ÐMn-‰_þlŠË‹BúÂùóêï©ô| ÃêK m Â7‘fšHï7 ‰!/me[M$6)‰,*},`1—184,5°4Ž8Ö9‘9³5b89ž55O<ž>È;Œ6þ>x0Â,3)Æ(W(d*»)Ü,-+@)d&¬*d(«$k(/l3b3l4¹8Ê961û1F,B,1;1€1Ì5ó-g(^#g$" aåø¥ kà Ô&û'Â,».³# W.3,1â161“.i1]/E-W()%#£$£!Ú˜609@:Œ;”>(As;= 9çEtEX4Æ1U21î+©*›+$(Ë)Ñ(X'”&¬%ê%q2ï2÷7ï7³2N.*(- '(Ïê>°BòAQ=%DÖ854x1Ÿ.0u3#/<1§5P6À7x3W0Q2'/0ß-T,ñ)Ð709_:ó? >=Au?hF`BdI\GO7Ÿ8ª5:2}8:»9Ê%&K(/'&ƒ)z"b$/ "ª!˜&€'äÈ4áç(ý-µ1×4M/Ä,o(w-d%T*A&a#j2y6z5ª9^6;/?“9t0Ì/Š1@3£)³/õ16û9.1(S' $«(×9t>ŠBŒFú?ô<Û<£AÓB³G/? APD[EÌJO@ÔBWGŠ>‚H÷?ïEFpAáB’FÿIêG[J­PkSÌHøKpOÉIIRK“OìQYV§X/\|WA\Ì]•ZUaÀT–U§UþVšZŽZÄU†U”[[²S˜W€UkW=Qƒ^ëdXe`h0hm¹qMsžqŸc cŽ_abõeâeœZŸVrWV¬Q=L]GæJÂYNZ^#]š[‡W([·b fkdìfVk2mŠr~uDyÖ| |b`Å\>[¬_Ÿ\od~Y"UWMTûR8NšJÅO7GiKÛH[Ñ^Q`ÏaLb(_Dc`4côbSd«`[a#gÐkhlŽm[æWrR^PwW:[ü] _:a„cµd¡hÜPPLGFDaJŒOPQÄSýU¹VÁFA×A²>AºA6D‹=E¯E©KJNùB“<±D.LPºPºL¬P…JÌHU@VR¯Q[Ø]>YòQÀMANuKŸKH D}G…AöCÙRªS}UëZtV²SÉVôTW@RÌTÁPbPÏVÂ\H\û`b.eÁfOk7LHH¥C?pIúJPM,RâVYZüUB…=“<<7±=ã8©8Ø2®@D?“=ƒ:­DËC–HÅ?=>7Á4f@Ø?Ú<ÕB72"-Ž)€2„-N.\/˜.[*"(Â$I+&ç'ç&m*},®, +-„'ƒ%êû'Â-S-W+Þ.õ?”\0Ç;q  c¥ýŸýù¢V§#x٠ڝ,ïÀ=ëg!Óœ#Z”ã"›$%6ú  %×*Š.1x,€*Š%P.È2©0ª3Á46Ž9$:\+„))î*Y#0 ž!­*)*á0­2(Œ"Ä (,‰3æ9qÿVú, ?ŠRÂ="aUP3à2 €ïnt Ò Y·þ&ùñýå‚ú– LG"·Q°A"$¿)-%¥#`$£ø!î$(­(‹Ÿ õ-O21t2Ñ3,3v5+1Ó/g.**Ø,œ39&"a%/$—.#yœ(Ê,-/43«(Í& ,,š/o2­6Æ+¡) .V,»0¹3B8îëBÃGP>žBû@ÉDDMFtBQ=B&<‚BCsH5KÞ>Â; 7¶7µHK…QTÞIÍL¬N^M$Q7V0XÚ][UmUoXØQ³W–SMIPMJ†KâUõXQZ+]±T‹OàRÖLŠW¶Y ^ìaPUçVËS<NŠU‚afiçn)gºd†f6`gÙkjAl•in`prp fñeYj,jÑa^Àbs]4moru¯wÁtÚyA{¹yü•v_y uÊqz!~ƒx=uNqùs[yŽ~:}æm¢j h3g;e“a \abÒgÇfbdŠdájüi®b¢`dcD]W|W6SæhMlqnÀoíp®tÚyöz}çoVrnÚpýsNwM|à€à†@iÆfVdÁc&a§]i_xeDdjhúhKcŒ^óm‰rqŒsKw{ë€ñ‚`ƒ`o"nBj‘k”kíli>iŸg:gÕd$f\b`_E_b^µat\’Y?TlP'UDQîLòHŠUSAOáTùN'S>OëNIM±IbE¡@þK^NHGÇDß?×;—HPLP5TmWæ@{ýAgCœ9K@ÁBìHÑKœ@1@×>ó:zBžJˆP RêVÖPÎVJVƒ[æ\P×S\RŸUrQ`KŸJûI1NÐN!SET¬I€IEDE @œUñZ‘^×aÕ\ˆ`²ba`f8^ÿbþbƒfIbšfR]Ö\VŸS¹_S\ñZ’]ŽU O’NÞKdL!N‰J•FÛK|R#SN:KÊWœW&U7LþKBEOB–N)S1JœW“Cy=ç;6ö<Û74G4i=D:÷:,6>ã?HBì;ÿCJ<]?þ@X>/>9S6}CHDGFÎ8–4Š/;, 4ž.Z)_(¹$ƒ(Û("›!ûâ,ö,Ÿ+ç)ß1‡1­7:8Ÿ==r@Í-,[&%/-‘*«)ü(œ'B&%h"Õ#P±ÐDFI“.ü±îkÍK‡"{$z%v'Q)r)é&<&$#i$-$ƒ*=-³!€ +0S2Š7h0a-º-—0W*=//0×4I8*,"-à);&å(2œ5·:5>¬1ï-t3Û8Þ<{A‰EÎ9æ=G:?Ü@âEQIMÏC6@GFÇIÐL…QFXD£AD@\=Ä=T;¥I§KŠOmRÂFÍC‰C€NßR¢X[ÿPÈTàWVJZæZ\PX!]_qd5\3ZÖY0WÂVK\ ]Ê_pbìYg[`,Wõ\Ú^ ^YÜY±Yƒ]šU4]~U Y0Yb«cX`9^Oi)l£ltoéo®s$rõ_Î]qWšUè]ÎcXe)eÝTÙO/M4P=LÔM]OPHErEE«@?3D|CâDùAv=?D @A†COAŽÈB%<,7ý3K1þ9ð>?@$DFh0â,Â(ù$F/z1Ž6à.Š8ù0£5À7»+)(*&á(X..d.01Y23»/'1‹0p/•7r:<ç@)0~/x)í(ï00,#&w! °ù|¿  #q#%"x&l&€(.ï)‡,+)=)a1Û4Ì:±=ˆ<]&š$ 0ô È­… í G pUÿ P š Q!Æ+/hJ!S&(e%3%v-Õ1Q2*3’5f6Î7§"AAûÌ#$˜(Zž] TkB ‚Aa: fZÑ3qó@Œ±x!˜Þñ*% ^dÊŸNãûÏ:W¶&µúU9 H"ˆ þ‹†Û=·  ~£š !6²óþŸú²£€0€ìû*ö0õ—ï1‹ l . ‚ ‘Œ× ×’|úû`2R Ò mZy Žôuæ,ð "µ ¢'bE,0ú¬£Þö >$Oc ÕϝV î  ë4w f; . ~m`þÒ‚õ |Ê.¯ý&ø¯Óþuúö|ñÓøôzõ\ôoøpõ ñ]òtò+ö>îúíèDèûæ‹ãªâ¹ÞÂßÌìUí7îßíŸñ)ò»ö,ñJöÁóºñ†ó—ïït÷*ú¿ëæ»âŒÞUä«á×éÝ«ãÜáWäá‘áÜ|Ý3ۙéGìiì,ëçò"õ‘ùíó‘ìIì;æÿæÝíEóöÁõŽûúæóÃþ•÷üœâÑÝ®ÛÓؔÙæجÛþÔ(Ýö܍Ý7Ú)ßÅÝÒà¬߄ä6á9âÞÆÝ@èìSî•íOÝiÛ0ÕEғÝhÞ âEٙÓkÍøÊƬÌûÇ}ÖÅÆËôÈÚȔÄlË ÇfÉNÇÇÌÍÍ;ÊnÉÊÒÞÕÈžÆoÊsÌ2Ä/ǏÈÑËÒϓ͒ÈéÐÅÌÝÏǍÑ1ÏÎÔ©ÙÍDËÓÓ¿×ÚÜà¥Ջ×iÝaÕÚ5Ýžà•å:ÚÃރÝëÞåÜcÝ­ß®äè)Û?×yÙqÕŠאã+æÆë-ï^ãÔãæ¡êîñêö}ë˜èÈïíó@ötúìðó‹ðNîCïñô ö¥ûJŠòãõAñÁóòò ôhíÉúRþIýøŒþš»€ý7ÿPøôÊóSóÆïÕìÄèšî)å·ëFç2äxñ™ïˆóðóìÂð,ø€ýýÀþ ô|6 aýüÿ1úþü#ªm |_ ® x& Ó‘¯ö8ñ»ñÌñ*ìšìÚð¡é³ïÀëtò‘ò öúöËñõ·ùóÑû2ôtºö ƒ Sþ%þuù>ø È ŽŠ=öGñÚð ïàíNè¿ä%ÞÙîùìÄñó‚é¯ç¯äéˆâ5ç®äñàõÈôµø0ûHÿVßîFïàîpï!ëmñ€ïèòöñ—ôŽóæôáôpóUú:úh‹šÿ8õSôîÑíe÷/õWýëŸåýä(àîæKä÷æÉä%ç3äcåàëâ߄ëJíÃêŽéJó\õáéTæwàÓÞ9æïäÞeæüßÚÚ*ֈÞXÞîß>ܘã»ãÙàÝzß¶âã5ÝùܔæŸæ`äóç”äžçYåîå¶Û7ÖäÒÎtÕáÒñÓ ÔàÒRÎcÎýË+ÎÑÊWÉžÅWÃw¿sÅ«ÓÐÔòÔ ÒQڎÛlÕ;ÔûÏNÍ€ØØÈÝ݌à>âŽàkÌ}Ç ƪÄwÃŽÄEÀoÁJœÈÕÈ€ÄdĆÍñΧΖÏAÀºŒ{¹·+¹ µKµÃ¹®·&¹œ··<³n³šµ4²&ŸÝÁÖÀúÀÿǖÈnËÆÀ>¿¹žž°¿K¶6°ú±­y­H§–£Ú¢<¢”µR¶·™µ8¹Ô¹YŽýŽŸ°»œÍººjÃWÃÑÂÈɶŸ²e¯f­»®ôªŠ™¡+×®Ï«†­ÂªÕªéŠ£¥Á¢zš ²íµ—޲X»„Ÿ8Žê²Ê³Z¯ŠµŒŽv··¯ž#¹š¿gÀÙ¶6µ¡³Z¶ ®šÂÒÇþËzÌœÊ+ÇvÂÌôÒ@ÒLÔìÔ{×;ØÖJÏ^ÏÍCÏgË·ËÇYÐmÉPÇ(ËfË«Ã$Ÿ2œçº¹?µaµ7°ÒΜÒ¢Ö"×I՝ÙL֐ÞX׺ہÙ[Ü#ÜÀÔkÑòÑ0ÒÌŸ͟ϕӵ̥ψÍGєЙÊ ÅÂÎÀÁœË»HœiÖ@ÚàÚúÛäߌäåÍçÐêƒì…í£òÚÚqÖäØMÒ[Î4Ï@ÎÓÉ'Ä7Â#Á蜎œS»?КÐæ֗׬Í¡ËqÆËÃ4ÆþÚ߀áQÞ á æ\ægè‡è,çîî+ñÖ÷púàø)è&è ãFã è è‹é·æDîÂÞëÚÚØðՆ×ЙÛ%ÚMÝPÛFÛ°Úö؏àâå•ãPãÝêûìsï"àÎÞÔÙ·ØÖÝåãâ#ç ç‹ì-ãHÖyÑIёÎ'ÍÔÑÌÇÕ«ÖÁ×»Ö6Û²ÞÛ/ã3ÝnårâƒÚBÛªÖÍÖkà,å9éîˆò®Ó4ÎVʋÇTËÅǂÇDÄ+Ë Ç»ÊáÌeãÀŒ¿À ¹XŒŠ¹w¶AËÆφÍæÑ9ϖÑé×ÎÆÙHÐïÖ$ÈËưÈ0ÊÐÀºŸŠ»ˆÀÆuÆÛÇ"ƕÂPÃ6œÇþÆÀœ™È¢ɑÊÞœ¶ž%ޱ¶V·K»nÀ¯ó¬öªt«Išø€Œ¥’Ÿ¢¡%x§q£³Š}¥“Ÿ œ—f”Œ ©×­6®¹­Ñ²$±°D²{¯Å±ü°§°.°ÿ޳=²Ÿ¹ä»¿ÀüÀ!ŒÀjdz±¯«÷ª¥²Ž±Uªöªèš¹£/¢Tž” s›¡a¥ß¥Ÿ§õ¥ÚšÂ§i©ì£P¬F¯&«Ò«ŠŽ· œ¿œ0©cŠ©¡£Ÿá¥£.£"ŠªžóŸwšy›;˜€žÊŸ§Ÿ›b€ý€­¢”¥fÔ¢é£ŠÑ¥Q€†€«¬¯­³3³=³¯Ç³N°²·®Þ¶žäœœ¿£º™¶µO²à±!®²­é¿›Ä`à ÅÝÇRʎÎïÇŸÄŸŸ9Á¹¹‰µÆœ]·NŒº’¹œUœÜŽ8µ·©ÀUÄrÉḑÅCÀ’Â:œ²ÉÊÍýÍÐÈÎ-Òïҍ×nÈÆ£ÆúÉÁ>ÀÝŒ%ĪœÂcÄÚÄXɋÊŸÀX¿:ŒÁT»ÀGœ2Œ3Ì|ÑjÕ¥×!ÑÕüÙYÖA×wÛ9àŸâþÛzܵ£€ €0€ €血0€ˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆˆ0€ €¡€0€€€helix¢€ €¡€0€ €¡€¡€0€0€ €¡€ ¢€¡€¢€0€ €0€ €B@¡€÷¢€i °£€†c0¡€0€ €B@¡€@)È¢€»|£€»Ë¢€0€ €¡€0€ €¡€0€€€helix¢€ €¡€0€ €¡€¡€0€0€ €¡€¢€%¡€¢€0€ €0€ €B@¡€ Vࢀ ”ˆ£€ø0¡€0€ €B@¡€ÃP¢€•"Ø£€ÿIòˆ¢€0€ €¡€0€ €¡€0€€€helix¢€ €¡€0€ €¡€¡€0€0€ €¡€2¢€?¡€¢€0€ €0€ €B@¡€È:š¢€cY˜£€ÿDp`¡€0€ €B@¡€¹Y8¢€ix£€׿P¢€0€ €¡€0€ €¡€0€€€helix¢€ €¡€0€ €¡€¡€0€0€ €¡€B¢€I¡€¢€0€ €0€ €B@¡€R+(¢€Dãࣀþ؃x¡€0€ €B@¡€ø;ž¢€Îɀ£€ÿËø¢€0€ €¡€0€ €¡€0€€€helix¢€ €¡€0€ €¡€¡€0€0€ €¡€O¢€V¡€¢€0€ €0€ €B@¡€ôn7¢€˜%8£€ÿe¿ž¡€0€ €B@¡€’|¢€æp£€ÿ3€p¢€0€ €¡€0€ €¡€0€€€helix¢€ €¡€0€ €¡€¡€0€0€ €¡€[¢€e¡€¢€0€ €0€ €B@¡€kŽP¢€|û@£€ÿC됡€0€ €B@¡€ný8¢€·ŒH£€–|H¢€0€ €¡€0€ €¡€0€€€helix¢€ €¡€0€ €¡€¡€0€0€ €¡€n¢€u¡€¢€0€ €0€ €B@¡€†Ç袀y‘£€þŽࡀ0€ €B@¡€bࢀ²cø£€þ¿R@¢€0€ €¡€¢€0€ €0€ €†Ÿ¡€0€ €99999¢€0€0€ €;š£T¡€0€ €T079 0¢€0€0€ €þÄÀ|¡€ T079 0 M797 0¢€È€€¢€0€ €¡€0€ €†Ÿ €÷0€¡€¡€0€0€ €¡€ ¢€|¡€¡€0€0€ €¡€ ¢€|€€0€0€ €¡€0€¡€0€ €'¡€þb¢€ý²<£€²R €0€ €'¡€i¢€à£€@€€Ü¥€öIŠ€ ާ€û#š€êੀ߁¡€0€ €'¡€ü’¢€H£€Ùý¥€0€0€¡€'€€t¥€®Ã£€1€ €0€ €1€ €¡€T079 0¡€1€Ž€0€ €¡€0€ €Ρ€¢€¡€&Transcriptional Activator; A Bipartite¢€0€£€0€NAŠ€Revision History:~ NA NA «€0€ €1€¡€0€ €0€ €¢€0€S.Rhee R.G.Martin J.L.Rosner D.R.Davies¡€0€ €¡€0€ €Ρ€¢€§€¡€0€ €¡€0€9101112131415161718192021222324252627282930313233343536373839404142434445464748495051525354555657585960616263646566676869707172737475767778798081828384858687888990919293949596979899100101102103104105106107108109110111112113114115116117118119120121122123124¢€0€ € ¡€ ¢€Š€¡€AMTMSRRNTDAITIHSILDWIEDNLESPLSLEKVSERSGYSKWHLQRMFKKETGHSLGQYIRSRKMTEIAQKLKESNEPILYLAERYGFESQQTLTRTFKNYFDVPPHKYRMTNMQGESRFLHPLNHYNS£€1€0€€€ €1€0€¡€°€ €€helix 1Š€£€0€ € ¡€£€ €¡€T079 00€¡€°€ €€helix 2Š€£€0€ €(¡€2£€ €¡€T079 00€¡€°€ €€helix 3Š€£€0€ €7¡€I£€ €¡€T079 00€¡€°€ €€helix 4Š€£€0€ €N¡€U£€ €¡€T079 00€¡€°€ €€helix 5Š€£€0€ €Z¡€d£€ €¡€T079 00€¡€°€ €€helix 6Š€£€0€ €h¡€o£€ €¡€T079 00€¡€š€Domain 1€€ NCBI DomainsŠ€£€0€ €5¡€€£€ €¡€T079 0 €0€ €1€ €¡€M797 0¡€1€Ž€0€ €¡€0€ €Ρ€ ¢€¡€Casp3 Model Structure¢€0€£€0€NA€€X-Ray DiffractionŠ€Revision History:~ NA NA «€0€ €1€¡€0€ €0€ €¢€0€¡€0€ €¡€0€ €§€¡€0€ €¡€0€123456789101112131415161718192021222324252627282930313233343536373839404142434445464748495051525354555657585960616263646566676869707172737475767778798081828384858687888990919293949596979899100101102103104105106107108109110111112113114115116117118119120121122123124125126127128129¢€0€ € ¡€ ¢€Š€¡€AMTMSRRNTDAITIHSILDWIEDNLESPLSLEKVSERSGYSKWHLQRMFKKETGHSLGQYIRSRKMTEIAQKLKESNEPILYLAERYGFESQQTLTRTFKNYFDVPPHKYRMTNMQGESRFLHPLNHYNS£€1€0€€€ €1€0€¡€°€ €€helix 1Š€£€0€ € ¡€£€ €¡€M797 00€¡€°€ €€helix 2Š€£€0€ €¡€$£€ €¡€M797 00€¡€°€ €€helix 3Š€£€0€ €1¡€>£€ €¡€M797 00€¡€°€ €€helix 4Š€£€0€ €A¡€H£€ €¡€M797 00€¡€°€ €€helix 5Š€£€0€ €N¡€U£€ €¡€M797 00€¡€°€ €€helix 6Š€£€0€ €Z¡€d£€ €¡€M797 00€¡€°€ €€helix 7Š€£€0€ €m¡€t£€ €¡€M797 0€€1€0€£€1€¡€FVAST structural alignment for pdb|T079| , mapped to sequence alignment€€¡€1€0€ € ¡€¢€1€0€ €¡€ VAST score¡€ € 00€ €¡€ VAST p-value¡€ € 00€ €¡€6VAST root mean square deviation, measured in angstroms¡€ € 11.02750€ €¡€VAST aligned residue count¡€¡€t£€ €0€0€ €¡€0€ €¡€T079 0 €¡€M797 0¢€0€£€t